Duffyella gerundensis: EM595_0385
Help
Entry
EM595_0385 CDS
T04258
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
ege
Duffyella gerundensis
Pathway
ege03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
ege00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
EM595_0385 (rplR)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
ege03011
]
EM595_0385 (rplR)
Ribosome [BR:
ege03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
EM595_0385 (rplR)
Bacteria
EM595_0385 (rplR)
Archaea
EM595_0385 (rplR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Ribosomal_L5e
Motif
Other DBs
NCBI-ProteinID:
CUU22622
UniProt:
A0A0U5KXN3
LinkDB
All DBs
Position
1:427277..427630
Genome browser
AA seq
117 aa
AA seq
DB search
MDKKSARIRRATRARRKLKELGATRLVVHRTPRHIYAQVIAPNGSEVLVAASTVEKAITE
QLKYTGNKDAAAAVGKAIAERAIEKGITGVSFDRSGFQYHGRVQALADAAREAGLQF
NT seq
354 nt
NT seq
+upstream
nt +downstream
nt
atggataagaaatctgctcgtatccgtcgtgcgacccgcgcacgtcgcaagctcaaagag
ctgggtgctactcgcctggtggtacatcgtaccccgcgtcacatttacgcacaggtaatc
gcaccgaacggttctgaagttttggttgctgcttctactgtagaaaaagctatcactgaa
caactgaagtacaccggtaacaaagacgctgcagctgctgtgggcaaagccattgcagag
cgcgcaattgagaaaggcatcactggtgtctctttcgaccgttccgggttccaatatcat
ggtcgcgtccaggcactggcagatgctgcccgtgaagctggccttcagttctaa
DBGET
integrated database retrieval system