Duffyella gerundensis: EM595_0960 Help Entry EM595_0960        CDS       T04258                                  Symbol xseB Name (GenBank) exonuclease VII, small subunit   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism ege  Duffyella gerundensis Pathway ege03430   Mismatch repair Brite KEGG Orthology (KO) [BR:ege00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     EM595_0960 (xseB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ege03400]     EM595_0960 (xseB) Enzymes [BR:ege01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      EM595_0960 (xseB) DNA repair and recombination proteins [BR:ege03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      EM595_0960 (xseB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S DUF5536 Motif Other DBs NCBI-ProteinID:  CUU23196 UniProt:  A0A0U5LLJ0 LinkDB All DBs Position 1:complement(1061224..1061478) Genome browser AA seq 84 aa AA seqDB search MRPTMPKKAATPVSFESSLQQLEQIVQRLESGDLPLEDALNEFERGVQLARVGQQTLQQA EQRVQILLSDDKNGELTPFTAENE NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagacccactatgccaaaaaaagccgcaacgcccgtcagctttgaaagctctctgcaa cagctggagcaaattgttcaacgcctcgaaagtggcgatttgccactggaagatgccctc aacgaatttgagcgcggcgtgcagctggccagagttgggcaacagacactacaacaggcg gaacagcgcgtacagatcctcctcagcgacgacaaaaatggtgagctgaccccttttaca gcggaaaatgaataa

DBGET integrated database retrieval system