Duffyella gerundensis: EM595_1122 Help Entry EM595_1122        CDS       T04258                                  Name (GenBank) putative membrane protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism ege  Duffyella gerundensis Pathway ege00190   Oxidative phosphorylation ege01100   Metabolic pathways ege02020   Two-component system Module ege_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ege00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     EM595_1122  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     EM595_1122 Enzymes [BR:ege01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      EM595_1122 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  CUU23357 UniProt:  A0A0U5E825 LinkDB All DBs Position 1:1225258..1225371 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGVITALAIEHVDATKSGSDAR NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttgcctggatcctcggcaccttgctcgcctgcgcatttggcgtgatcacc gccctggcgattgaacatgtcgacgcgacgaaatctggctccgatgccagataa

DBGET integrated database retrieval system