Duffyella gerundensis: EM595_1376 Help Entry EM595_1376        CDS       T04258                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism ege  Duffyella gerundensis Pathway ege01100   Metabolic pathways ege01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ege00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EM595_1376    00074 Mycolic acid biosynthesis     EM595_1376   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EM595_1376 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CUU23610 UniProt:  A0A0U5KZ48 LinkDB All DBs Position 1:1494762..1495043 Genome browser AA seq 93 aa AA seqDB search MTCDVETIMDALIPEIKQMIIDTLNLEDLTPEDIDAQAPLFGDGLGLDSIDALELGLAVK NRYGVVLSAESEAMRQHFFSVASLAAFISAQRS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgacttgtgatgtggaaacaataatggatgcgttaatccctgagattaaacaaatgatt atcgatacgttaaaccttgaagatttaacgccagaggatatcgacgcgcaggcaccgctg tttggcgacggactggggctcgactccatcgacgccctggagctgggactggcggttaaa aatcgctacggcgtggtgctctctgcggaaagcgaagcgatgcggcagcacttcttttcg gtcgcctcgctggccgcgtttatcagcgcgcagcgcagctaa

DBGET integrated database retrieval system