Elizabethkingia ursingii: BBD34_11665 Help Entry BBD34_11665       CDS       T05036                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ego  Elizabethkingia ursingii Brite KEGG Orthology (KO) [BR:ego00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ego03032]     BBD34_11665    03036 Chromosome and associated proteins [BR:ego03036]     BBD34_11665    03400 DNA repair and recombination proteins [BR:ego03400]     BBD34_11665 DNA replication proteins [BR:ego03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BBD34_11665 Chromosome and associated proteins [BR:ego03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BBD34_11665 DNA repair and recombination proteins [BR:ego03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BBD34_11665 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 FtsL_2 Motif Other DBs NCBI-ProteinID:  AQX09260 UniProt:  A0AAJ3NBA3 LinkDB All DBs Position complement(2544258..2544545) Genome browser AA seq 95 aa AA seqDB search MNKSELIDAIAKDADITKVAAKKALESFISNVSSTLKKKDGKVSLVGFGTFSVAERAARQ GINPSTKKPIKIAAKKVAKFKAGSELAESVNGKKK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaacaagtctgaattaatcgacgcaattgcaaaggatgctgatatcactaaagtagca gctaagaaagcattagaatctttcatttctaatgtatcttctacattgaagaaaaaagat ggtaaagtatctttagtaggtttcggaactttctccgtagctgaaagagctgctagacaa ggtatcaacccttcaacaaagaaaccaattaaaatcgctgctaaaaaagtagctaagttt aaagctggttctgagttagcagaatctgtaaacggcaaaaagaaataa

DBGET integrated database retrieval system