Eucalyptus grandis (rose gum): 104419631 Help Entry 104419631         CDS       T03547                                  Name (RefSeq) SKP1-like protein 1B isoform X1   KO K03094   S-phase kinase-associated protein 1 Organism egr  Eucalyptus grandis (rose gum) Pathway egr03083   Polycomb repressive complex egr04120   Ubiquitin mediated proteolysis egr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:egr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104419631    04120 Ubiquitin mediated proteolysis     104419631   09126 Chromosome    03083 Polycomb repressive complex     104419631  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:egr04131]     104419631    04121 Ubiquitin system [BR:egr04121]     104419631    03036 Chromosome and associated proteins [BR:egr03036]     104419631 Membrane trafficking [BR:egr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     104419631 Ubiquitin system [BR:egr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      104419631    Cul7 complex      104419631 Chromosome and associated proteins [BR:egr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      104419631   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      104419631 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Methyltransf_16 Motif Other DBs NCBI-GeneID:  104419631 NCBI-ProteinID:  XP_010029647 LinkDB All DBs Position 9:complement(37068763..37071289) Genome browser AA seq 155 aa AA seqDB search MATSRKITLRSSDGESFDVEQSVAVESQTIKHMIEDGCADNAIPLPNVNSKILAKVIEYC KMHVESAKPEDRVNDEELKTWDVDFVKVDQATLFDLILSANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFSIRNDFTPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggcgacgtcgaggaagataacgctgcggagctccgacggggagtcgttcgatgtggag cagtcggtggcggtggagtcgcagacgatcaagcacatgatcgaggacggctgcgccgac aacgcgatcccgctgcccaacgtgaacagcaagatcctggccaaggtgatcgagtactgc aagatgcacgtcgagtccgccaagcccgaggatcgcgtcaacgacgaggaactcaagacc tgggacgtcgatttcgtcaaggtcgaccaggccaccttgtttgacctgatcctgtccgca aactatctgaacatcaagagcttgttggacctgacatgccagacagtggctgacatgatc aaaggcaagacccctgaggagatacgcaagaccttcagcatcaggaatgacttcacccca gaggaggaggaagaggtgcggcgggagaaccagtgggcgttcgaatga

DBGET integrated database retrieval system