Eucalyptus grandis (rose gum): 104422794 Help Entry 104422794         CDS       T03547                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism egr  Eucalyptus grandis (rose gum) Pathway egr03083   Polycomb repressive complex egr04120   Ubiquitin mediated proteolysis egr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:egr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104422794    04120 Ubiquitin mediated proteolysis     104422794   09126 Chromosome    03083 Polycomb repressive complex     104422794  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:egr04131]     104422794    04121 Ubiquitin system [BR:egr04121]     104422794    03036 Chromosome and associated proteins [BR:egr03036]     104422794 Membrane trafficking [BR:egr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     104422794 Ubiquitin system [BR:egr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      104422794    Cul7 complex      104422794 Chromosome and associated proteins [BR:egr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      104422794   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      104422794 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  104422794 NCBI-ProteinID:  XP_010033522 UniProt:  A0A059AH91 LinkDB All DBs Position 10:31464277..31466688 Genome browser AA seq 155 aa AA seqDB search MSSAKKITLRSSDGESFEVDEAVAVESQTIKHMIEDDCADSGIPLPNVTSRILAKVIEYC KKHVESAKPDDRTTEDELKAWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCLTVADMI KGKTPEDIRKSFSIKNDFTPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcggcgaagaagatcaccctccggagctccgacggggagtcgttcgaggtcgac gaggcggtggccgtcgagtcgcagaccatcaagcacatgatcgaggacgactgcgccgac agcgggatcccgctccccaacgtcaccagccggatcctggcgaaggtgatcgagtactgc aagaagcacgtcgagtccgccaagcccgacgaccgcaccaccgaggacgaactcaaggcc tgggacgccgagttcgtcaaagtcgaccaggccaccctcttcgatctcatcctggctgca aactatctaaatatcaagggcttgctggatctgacatgcctgactgtggcagacatgatc aaggggaaaactccggaggacatccgtaagagtttcagcatcaagaatgacttcacccct gaggaagaggaagaggttcgccgcgagaatcagtgggcttttgaataa

DBGET integrated database retrieval system