Eucalyptus grandis (rose gum): 104426693 Help Entry 104426693         CDS       T03547                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism egr  Eucalyptus grandis (rose gum) Pathway egr03018   RNA degradation egr03040   Spliceosome Brite KEGG Orthology (KO) [BR:egr00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     104426693   09123 Folding, sorting and degradation    03018 RNA degradation     104426693  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:egr03019]     104426693    03041 Spliceosome [BR:egr03041]     104426693 Messenger RNA biogenesis [BR:egr03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      104426693   mRNA degradation factors    5'-3' decay     Lsm complex      104426693 Spliceosome [BR:egr03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     104426693  Complex C   U2 snRNP components     104426693 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX DUF150_C DUF1256 Motif Other DBs NCBI-GeneID:  104426693 NCBI-ProteinID:  XP_010038129 UniProt:  A0A059A8I3 LinkDB All DBs Position 11:complement(45332842..45334573) Genome browser AA seq 93 aa AA seqDB search MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FIRGSVVRYVQLPPDGVDIELLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttgttcttctcctacttcaaggacctggtgggcagggaagtgacggtggagctgaag aacgatctggccatcagaggcaccctccactccgtcgatcagtacctcaacatcaagctc gagaacactagggttgtcgatcaggacaagtaccctcacatgctgtcggtcaggaactgc tttatcagaggatcggtggtgaggtatgttcagctacctcctgatggagttgatattgaa ttgcttcatgatgccacaagaagagaagccaggggtggttga

DBGET integrated database retrieval system