Eucalyptus grandis (rose gum): 104435729 Help Entry 104435729         CDS       T03547                                  Name (RefSeq) ubiquitin   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism egr  Eucalyptus grandis (rose gum) Pathway egr03010   Ribosome egr04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:egr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     104435729   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     104435729  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:egr03011]     104435729    04121 Ubiquitin system [BR:egr04121]     104435729   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:egr04147]     104435729 Ribosome [BR:egr03011]  Ribosomal proteins   Eukaryotes    Small subunit     104435729   Archaea     104435729 Ubiquitin system [BR:egr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    104435729 Exosome [BR:egr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104435729   Exosomal proteins of colorectal cancer cells    104435729 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Rad60-SLD_2 UBL_UBAC1 Plexin_RBD TBK1_ULD Ubiquitin_5 Dsc3_N OTU1_UBXL HATPase_c Motif Other DBs NCBI-GeneID:  104435729 NCBI-ProteinID:  XP_010046733 LinkDB All DBs Position 1:27258856..27259301 Genome browser AA seq 78 aa AA seqDB search MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN IQKESTLHLVLRLRGGGF NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaagaccctgaccggcaagaccatcaccctcgaggtcgagagctcc gacaccatcgacaacgtcaaggccaagatccaggacaaggagggcatccctcccgaccag cagcgcctcatcttcgccggcaagcagctggaggatggccgcaccctcgccgattacaat atccagaaggagtctaccctgcacctcgttctccgcctccgcggaggcggtttctga

DBGET integrated database retrieval system