Eucalyptus grandis (rose gum): 104437500 Help Entry 104437500         CDS       T03547                                  Name (RefSeq) polyubiquitin   KO K03873   elongin-B Organism egr  Eucalyptus grandis (rose gum) Pathway egr04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:egr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     104437500  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:egr04121]     104437500    03400 DNA repair and recombination proteins [BR:egr03400]     104437500 Ubiquitin system [BR:egr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      104437500    Cul5 complex      104437500 DNA repair and recombination proteins [BR:egr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      104437500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Dsc3_N UBL_UBAC1 Ubiquitin_2 Rad60-SLD_2 Motif Other DBs NCBI-GeneID:  104437500 NCBI-ProteinID:  XP_010048761 UniProt:  A0A059CSE7 LinkDB All DBs Position 3:45042498..45048174 Genome browser AA seq 103 aa AA seqDB search MSMYIRVKRSKTTYFIQCEPTETILNVKEKLQNLTDQPATDQRLILVGTGEVLEDSKSLA DQKVENDAVVALTLRKDDNEFEEVNIVRPNDYCQSVDGDGSKW NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgagtatgtacattcgcgttaagcggagtaagacgacttactttatccagtgtgaacca actgagacaattcttaatgtcaaggagaaactgcaaaacctcacagaccaacctgctact gatcaacgtttgatcttggtagggactggggaagtgctggaggattcaaaatcactagct gatcaaaaggttgaaaatgatgccgtggttgcactgaccttgaggaaagatgacaatgag ttcgaggaagtgaacattgttcggccaaacgattattgccaatctgtcgatggagatgga agcaaatggtga

DBGET integrated database retrieval system