KEGG   Eucalyptus grandis (rose gum): 104440568
Entry
104440568         CDS       T03547                                 
Name
(RefSeq) monoterpene synthase-like isoform X2
  KO
K21926  (+)-alpha-terpineol/(4S)-limonene synthase [EC:4.2.3.112 4.2.3.16]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00902  Monoterpenoid biosynthesis
egr01100  Metabolic pathways
egr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    104440568
Enzymes [BR:egr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.16  (4S)-limonene synthase
     104440568
    4.2.3.112  (+)-alpha-terpineol synthase
     104440568
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2
Other DBs
NCBI-GeneID: 104440568
NCBI-ProteinID: XP_010051775
LinkDB
Position
Unknown
AA seq 595 aa
MALPALLTNFLPSSIRPNQHSFLLVSRPCSSFSSPSAISSGARFAKCSLTIEDQDTARRS
ANWKPSVWDYGSVQSLNTDFAEDKYTEQVQRLKEEVKGLFHREINQVAKLEFIDVVQRLG
LGYHFETDIKNALSSIYNNTEDAQLSDDLYAVSLRFRLLRQHGYNLQQDVFQRFMNKMGT
FNESLKEDVRGLLSLYEASFHGLEGETIVDEAWNFASKHLKDLNLDEVPANLASNVSHAL
DMPIHWRPNRLEARWFMDTYEKQQDKIPCLLRFAKVDFNIVQSIHKKEVSNMARWWVELG
ANKMTFFRDRLVEHYFWCCAMVFEPQYTEFREMTTKLTCMVTLIDDVYDVYGTLEELEVL
TDFIVRWDITDVDKLPLKIRACFLALYNTTNEIGYWMMRERGINPIPHMRKVWADECKAY
IKEARWYNKGIKPTLDEYVDNGVTSIGGLIMLLGSYFLTTDKPTEEGLDYVSNIPSVMHC
SAKILRLNNDLSTSSYELARGDNFKALECHMNETGASEEATREHIKHLVRKTWKRMNRDV
FEDYPYSGFGPFLGACLNLARASQCFYQYGDGHGLPDHETRAHIVSALFDPVPLD
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggctcttcctgctttgctcacaaacttcctcccctcctcgatccgccctaaccaacac
tctttcttactcgtcagtcgcccttgctcctccttctcctctccctccgccatctcctcc
ggtgctcggtttgcgaaatgttctttgactattgaagatcaagataccgcgagacgttca
gcgaactggaaacctagcgtttgggactatggctctgtgcagtcactcaatactgatttc
gcggaggataaatatacagagcaagttcaaaggttgaaggaagaagtcaagggtctattc
cacagggagattaatcaggtggccaagctcgagttcattgacgtggttcaaaggttagga
ctaggataccattttgagacggacatcaagaacgctcttagttccatctataacaacact
gaagatgctcagctttcagacgatctctatgccgtttcccttcgattccggctactcagg
caacatggatataacttacagcaagatgtgtttcaaaggtttatgaacaagatgggcacg
ttcaacgaatcgctcaaggaggatgtgagggggcttcttagtctttatgaggcttctttc
catggattggaaggtgaaaccatagttgatgaagcttggaactttgcttctaagcatctg
aaggatctaaacctcgacgaagttcccgctaacctagcgagcaacgtgagtcatgcatta
gatatgccaatccactggaggccaaacaggttggaggctcggtggttcatggacacgtac
gagaaacagcaagacaagatcccttgtttgctacgatttgctaaagtagacttcaatata
gtgcagtcaatccataagaaggaagtcagcaacatggcaaggtggtgggttgaacttgga
gcgaataagatgaccttctttagggacaggctagtggaacactatttttggtgttgtgca
atggtttttgagcctcaatatacagaattcagagaaatgacgacaaaactcacttgtatg
gtgacacttattgatgacgtttacgatgtgtatgggacattggaagagcttgaggtctta
acagatttcattgtcaggtgggacatcacggacgtcgataagcttcctctaaaaataagg
gcttgtttcctggccttgtacaacacgaccaacgaaattgggtattggatgatgagagag
cgaggaatcaaccctattcctcacatgcggaaagtgtgggcggatgaatgcaaggcatac
attaaggaggcacgttggtacaacaagggcattaaaccgacactggacgagtacgtggac
aatggggtgacttcaattggaggactgattatgctgttgggtagctacttcctaaccacg
gacaaaccgacggaagagggacttgattacgtgtcgaatatcccaagtgtcatgcattgt
tctgccaagatccttcgactcaacaatgatctcagtacatcatcgtatgaattggcacga
ggggacaacttcaaggcactagaatgccatatgaatgaaactggcgcttcggaagaggcc
acacgggaacacatcaagcacctggtgcgcaagacctggaagaggatgaatcgagacgtg
tttgaggactacccatattccgggtttggacctttcctcggtgcctgtttgaacttggcg
cgagcttcccagtgcttttaccagtatggagatggacatggccttcccgatcatgagacc
agggcccatattgtgtcggctttattcgacccggtgcctcttgattag

DBGET integrated database retrieval system