Eucalyptus grandis (rose gum): 104441351 Help Entry 104441351         CDS       T03547                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism egr  Eucalyptus grandis (rose gum) Pathway egr04145   Phagosome egr04148   Efferocytosis egr04517   IgSF CAM signaling egr04518   Integrin signaling egr04519   Cadherin signaling egr04620   Toll-like receptor signaling pathway egr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:egr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     104441351    04518 Integrin signaling     104441351    04519 Cadherin signaling     104441351  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     104441351    04148 Efferocytosis     104441351  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104441351  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     104441351  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:egr04131]     104441351   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:egr04147]     104441351    04031 GTP-binding proteins [BR:egr04031]     104441351 Membrane trafficking [BR:egr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     104441351  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     104441351   Macropinocytosis    Ras GTPases     104441351  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     104441351 Exosome [BR:egr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104441351   Exosomal proteins of other body fluids (saliva and urine)    104441351   Exosomal proteins of colorectal cancer cells    104441351   Exosomal proteins of bladder cancer cells    104441351 GTP-binding proteins [BR:egr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     104441351 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sua5_C Motif Other DBs NCBI-GeneID:  104441351 NCBI-ProteinID:  XP_010052779 UniProt:  A0ACC3L5R0 A0A059CEG2 LinkDB All DBs Position 5:complement(4880490..4884207) Genome browser AA seq 210 aa AA seqDB search MSSAATVTGKAGATGSETRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSAN VLVDGQTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISRPSFENIAKKWVPELRH YAPSTPIVLVGTKLDLREDKQFKLDYPGACTISMEQGEELRKQIGALAYVECSSKTQQNV KAVFDAAIKVVLRPPKRKKQQRRLSVCQIL NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgagcagtgcagcaacagtcacaggcaaagcaggagcaacaggatcagagaccaggttc atcaagtgtgtcaccgttggtgatggtgctgtaggcaagacttgcctcctcatctcctac accagcaacactttccccactgattacgttccaactgtttttgataacttcagtgccaat gtcttggttgatgggcagactgtgaatctgggtctctgggacactgctggccaagaagac tataacaggctgaggcctttgagttacagaggagcagacgtcttcatccttgctttttcc ctcatcagtaggccaagtttcgagaacattgccaagaaatgggttccagagttgagacat tatgctccgtcaactccaattgttcttgtggggaccaaactagatctaagagaagacaaa caattcaaactagactaccccggagcatgcactatttcgatggaacagggtgaagaactg aggaagcaaatcggggccttggcatatgtcgagtgcagctcgaagacacaacagaatgtg aaggccgtgttcgatgcggcgatcaaggtggttctacggcctcctaagcgcaagaagcaa cagagacggttgagcgtttgtcaaatactttag

DBGET integrated database retrieval system