KEGG   Eucalyptus grandis (rose gum): 104441383
Entry
104441383         CDS       T03547                                 
Name
(RefSeq) aspartate aminotransferase, mitochondrial
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00220  Arginine biosynthesis
egr00250  Alanine, aspartate and glutamate metabolism
egr00270  Cysteine and methionine metabolism
egr00330  Arginine and proline metabolism
egr00350  Tyrosine metabolism
egr00360  Phenylalanine metabolism
egr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
egr00710  Carbon fixation by Calvin cycle
egr00950  Isoquinoline alkaloid biosynthesis
egr00960  Tropane, piperidine and pyridine alkaloid biosynthesis
egr01100  Metabolic pathways
egr01110  Biosynthesis of secondary metabolites
egr01200  Carbon metabolism
egr01210  2-Oxocarboxylic acid metabolism
egr01230  Biosynthesis of amino acids
Module
egr_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
egr_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation by Calvin cycle
    104441383
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104441383
   00270 Cysteine and methionine metabolism
    104441383
   00220 Arginine biosynthesis
    104441383
   00330 Arginine and proline metabolism
    104441383
   00350 Tyrosine metabolism
    104441383
   00360 Phenylalanine metabolism
    104441383
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    104441383
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    104441383
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    104441383
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:egr01007]
    104441383
Enzymes [BR:egr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     104441383
Amino acid related enzymes [BR:egr01007]
 Aminotransferase (transaminase)
  Class I
   104441383
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 104441383
NCBI-ProteinID: XP_010052823
UniProt: A0A059DHE5
LinkDB
Position
1:complement(38995470..39000212)
AA seq 426 aa
MAAAVRAGVSGRILGRGSAVGARSMSSWWRSVEPAPKDPILGVTEAFLADPSPDKVNVGV
GAYRDDNGKPVVLECVREAERRIAGNQNMEYLPMGGSVKMVEETLKLAYGEDSEFIKDKR
IAAVQALSGTGACRLFADFQKRFSPDSQIYIPVPTWANHHNIWRDAHVPQRTYHYYHPES
KGLDFAALMDDVKNAPNGSFFLLHACAHNPTGVDPSEDQWREISYQIKVKGHFPFFDMAY
QGFASGDPERDAKAIRIFLEDGHAIGIAQSYAKNMGLYGQRVGCLSVLCEDEKQAIAVKS
QLQQLARPMYSNPPVHGALVVSTILGDPELKSLWLKEVKVMADRIIGMRTALRENLEKLG
SPLSWKHITEQIGMFCYSGMTPEQVDQLTKEYHIYLTRNGRISMAGVTTGNVGYLANAIN
EVTKSS
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggcggcggcggttcgcgccggcgtttccggccggatcctgggccggggctccgcggtc
ggggcgagatccatgtcgtcgtggtggcggagcgtggagccggcgcccaaagacccgatc
ctcggcgtcaccgaggccttcctcgccgaccccagccccgacaaagtgaacgtcggcgtt
ggtgcttaccgcgatgataatgggaagccggttgttcttgagtgcgttagagaagcggag
cggagaattgccgggaaccagaacatggaataccttccaatgggtggcagtgtgaagatg
gtggaggaaacattgaagttggcatatggtgaggactctgagttcatcaaagacaaaaga
atagcagcagtgcaagctctttctgggacaggtgcatgccgcctttttgctgacttccag
aagcgctttagtcctgattcccagatttatatacctgtcccaacctgggctaaccaccat
aacatctggagagatgcccatgttcctcagaggacttatcattactaccaccctgaatct
aagggtttagattttgcggcactaatggatgatgtcaagaatgcaccgaatggttccttc
tttctacttcatgcatgtgctcataatcctactggggtggatccctcagaggaccagtgg
agagagatttcttatcaaattaaggtgaaaggtcattttcctttctttgacatggcatat
caaggatttgctagtggtgatccagaaagagatgcaaaggccatcaggatctttcttgag
gatggtcatgcaattggaattgctcaatcttatgcaaagaacatgggactgtatggtcag
agagtgggttgcctcagtgttctttgtgaagatgaaaaacaagcgatagctgtgaaaagt
cagttgcagcagcttgccagacccatgtacagcaatccacctgtgcatggtgccctggta
gtgtcaactattcttggcgatccagaattgaagagtttgtggctcaaggaagttaaggta
atggctgaccgaataatcgggatgcgtactgccttgcgagaaaaccttgaaaagcttggg
tcgccattatcgtggaaacacataaccgaacagattggtatgttctgctacagtgggatg
actccagagcaggttgatcagttgacaaaagaatatcacatttacttgactcgtaatggc
cgtataagtatggcaggtgtaaccactggtaacgttggatacctcgctaatgccatcaac
gaggtcacgaaatcttcttag

DBGET integrated database retrieval system