Eucalyptus grandis (rose gum): 104446319 Help Entry 104446319         CDS       T03547                                  Name (RefSeq) autophagy-related protein 8f   KO K08341   GABA(A) receptor-associated protein Organism egr  Eucalyptus grandis (rose gum) Pathway egr04136   Autophagy - other egr04145   Phagocytosis egr04156   Integrated stress response (ISR) signaling pathway Brite KEGG Orthology (KO) [BR:egr00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     104446319    04136 Autophagy - other     104446319   09143 Cell growth and death    04156 Integrated stress response (ISR) signaling pathway     104446319  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:egr04131]     104446319    04121 Ubiquitin system [BR:egr04121]     104446319    03029 Mitochondrial biogenesis [BR:egr03029]     104446319 Membrane trafficking [BR:egr04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     104446319 Ubiquitin system [BR:egr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    104446319 Mitochondrial biogenesis [BR:egr03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     104446319 SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 Motif Other DBs NCBI-GeneID:  104446319 NCBI-ProteinID:  XP_039168214 LinkDB All DBs Position 5:complement(16707338..16708047) Genome browser AA seq 76 aa AA seqDB search MLKTCRYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGTIMSAIYDEKKDED GFLYVTYSGENTFGDN NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgttgaaaacttgcagatatcttgtcccagccgaccttaccgtgggtcagtttgtctac gtgatcaggaagagaattaagctgagcgctgaaaaggcgatcttcatatttgttgacaat gtccttccacccacaggaacaataatgtctgccatttacgatgaaaagaaagacgaggac gggtttctctacgtcacctacagcggagaaaacacattcggtgacaactga

DBGET integrated database retrieval system