Eucalyptus grandis (rose gum): 104448856 Help Entry 104448856         CDS       T03547                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism egr  Eucalyptus grandis (rose gum) Pathway egr03083   Polycomb repressive complex egr04120   Ubiquitin mediated proteolysis egr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:egr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104448856    04120 Ubiquitin mediated proteolysis     104448856   09126 Chromosome    03083 Polycomb repressive complex     104448856  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:egr04131]     104448856    04121 Ubiquitin system [BR:egr04121]     104448856    03036 Chromosome and associated proteins [BR:egr03036]     104448856 Membrane trafficking [BR:egr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     104448856 Ubiquitin system [BR:egr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      104448856    Cul7 complex      104448856 Chromosome and associated proteins [BR:egr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      104448856   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      104448856 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  104448856 NCBI-ProteinID:  XP_010061081 UniProt:  A0A059BPH6 LinkDB All DBs Position 6:20589230..20590646 Genome browser AA seq 160 aa AA seqDB search MSSSRKIVLESSDKESFEVEVAVALECQTIKHMIEDDCAGDGIPLPNVSSKILSKIIEFC RKHVDADRERAGSASPAAADDELKAWDAEFIKVDQATLFDLILAANYLNIKGLLDLTCQN VADMIKGKTPEEIRKSFNIKNDFTQEEEEEVRRENQWAFE NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcctctcgcaagatcgtgctcgagagctcggacaaggagtcgttcgaggtggag gtggcggtggccctggagtgccagaccatcaagcatatgatcgaggacgactgcgccggc gacggcatccccctccccaacgtctccagcaagatcctctccaagatcatcgagttctgc cgcaagcacgtcgacgccgaccgcgaacgcgccggctccgcctcccccgccgcggccgac gacgagctcaaggcctgggacgccgagttcatcaaggtcgaccaggccacgcttttcgat ctgatcctggcggcgaattatctgaacatcaagggcttgctggatttgacctgccagaat gtggcagacatgattaaggggaagacccctgaggagattaggaagtcatttaacatcaag aacgacttcacgcaagaggaagaggaagaggttcgaagggagaaccaatgggcctttgaa tga

DBGET integrated database retrieval system