Eucalyptus grandis (rose gum): 104450132 Help Entry 104450132         CDS       T03547                                  Name (RefSeq) dynein light chain, cytoplasmic   KO K10418   dynein light chain LC8-type Organism egr  Eucalyptus grandis (rose gum) Pathway egr04517   IgSF CAM signaling egr04814   Motor proteins Brite KEGG Orthology (KO) [BR:egr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     104450132  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     104450132  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:egr03037]     104450132    04812 Cytoskeleton proteins [BR:egr04812]     104450132 Cilium and associated proteins [BR:egr03037]  Motile cilia and associated proteins   Dynein arm    104450132 Cytoskeleton proteins [BR:egr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      104450132 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  104450132 NCBI-ProteinID:  XP_010062873 UniProt:  A0A059BV86 LinkDB All DBs Position 8:complement(73536133..73537162) Genome browser AA seq 98 aa AA seqDB search MRLRSSDMPVHMQEHALRCTRSFLDSSPNLPPNNTHLARALKKEFDSVYGPAWHCVVGKS FGSFVTHSPGGFLYFSLDSLSVLLFQTVVQMVTEPAKS NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaggctgagatcgtcggacatgcccgtccacatgcaagagcacgcccttcgctgcacc cgatccttcctcgactcatctcccaacctccctcccaacaacacccacttggctcgtgct ctcaagaaggagttcgactcggtctacgggccggcgtggcactgcgtggtggggaagagt ttcgggtcgttcgtgacccactcccctggtggcttcctctacttctctctcgactcgctg tccgttctcctgttccagacggtggtccaaatggtcacggaaccggccaagtcgtag

DBGET integrated database retrieval system