Eucalyptus grandis (rose gum): 104450132 Help Entry 104450132         CDS       T03547                                  Name (RefSeq) dynein light chain, cytoplasmic   KO K10418   dynein light chain LC8-type Organism egr  Eucalyptus grandis (rose gum) Pathway egr04145   Phagocytosis egr04517   IgSF CAM signaling egr04814   Motor proteins Brite KEGG Orthology (KO) [BR:egr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     104450132  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     104450132   09142 Cell motility    04814 Motor proteins     104450132  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:egr03037]     104450132    04812 Cytoskeleton proteins [BR:egr04812]     104450132 Cilium and associated proteins [BR:egr03037]  Motile cilia and associated proteins   Dynein arm    104450132 Cytoskeleton proteins [BR:egr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      104450132 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  104450132 NCBI-ProteinID:  XP_010062873 UniProt:  A0ACC3KL05 LinkDB All DBs Position 8:complement(73536133..73537162) Genome browser AA seq 98 aa AA seqDB search MRLRSSDMPVHMQEHALRCTRSFLDSSPNLPPNNTHLARALKKEFDSVYGPAWHCVVGKS FGSFVTHSPGGFLYFSLDSLSVLLFQTVVQMVTEPAKS NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaggctgagatcgtcggacatgcccgtccacatgcaagagcacgcccttcgctgcacc cgatccttcctcgactcatctcccaacctccctcccaacaacacccacttggctcgtgct ctcaagaaggagttcgactcggtctacgggccggcgtggcactgcgtggtggggaagagt ttcgggtcgttcgtgacccactcccctggtggcttcctctacttctctctcgactcgctg tccgttctcctgttccagacggtggtccaaatggtcacggaaccggccaagtcgtag

DBGET integrated database retrieval system