Eucalyptus grandis (rose gum): 120290847 Help Entry 120290847         CDS       T03547                                  Name (RefSeq) dynein light chain-like   KO K10418   dynein light chain LC8-type Organism egr  Eucalyptus grandis (rose gum) Pathway egr04814   Motor proteins Brite KEGG Orthology (KO) [BR:egr00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     120290847  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:egr03037]     120290847    04812 Cytoskeleton proteins [BR:egr04812]     120290847 Cilium and associated proteins [BR:egr03037]  Motile cilia and associated proteins   Dynein arm    120290847 Cytoskeleton proteins [BR:egr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      120290847 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Y_phosphatase3 MinC_N Motif Other DBs NCBI-GeneID:  120290847 NCBI-ProteinID:  XP_039163285 LinkDB All DBs Position 1:complement(22722003..22723145) Genome browser AA seq 112 aa AA seqDB search MLEGRAVVREADMAEAMRSHVMDLAYQALDLHESADFQAIAHHIKQKFDEAYGSSWHCVV GKDFGSCITHLCGCFIFFHIDAMEFLIFKDGKDFTESKEEAVGALQRSTSSS NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgctggagggacgagctgtagtgcgcgaggcagacatggcagaagcgatgcgtagccat gtaatggacttagcctaccaagctctggacctccatgaatccgccgattttcaggccatt gctcatcatatcaagcagaaatttgatgaagcttacggttcgtcgtggcactgtgtggtc gggaaggactttgggtcatgcatcactcatttatgcgggtgcttcatattcttccacatc gatgccatggagtttctcatcttcaaggacggcaaggacttcaccgaaagcaaggaagag gcggttggagccctgcaaaggagcacaagcagttcttga

DBGET integrated database retrieval system