Eucalyptus grandis (rose gum): 120292136 Help Entry 120292136         CDS       T03547                                  Name (RefSeq) elongin-C-like   KO K03872   elongin-C Organism egr  Eucalyptus grandis (rose gum) Pathway egr04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:egr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     120292136  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:egr04121]     120292136    03400 DNA repair and recombination proteins [BR:egr03400]     120292136 Ubiquitin system [BR:egr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      120292136    Cul5 complex      120292136 DNA repair and recombination proteins [BR:egr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      120292136 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  120292136 NCBI-ProteinID:  XP_039166052 LinkDB All DBs Position 1:30384191..30387737 Genome browser AA seq 98 aa AA seqDB search MKKEGIVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGSFAETELGEVTFPEISTTILEK ICQYFYWSMQYASGKETEFHIEPELTLELMMAANYLHT NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaagaaggaaggcatcgtgaagctgatcagcgccgagggcttcgagttcgtgatcgac aagaaggccgccatggtctcccagaccatccgcaacatgctgacctccccagggagcttc gcggaaacggagctcggagaagtgacgttccccgagatcagcaccaccatcctcgagaag atatgccagtacttctactggtccatgcagtacgccagtggaaaggaaaccgagttccat attgaacctgaactgactttggagctgatgatggctgccaactatttacatacttga

DBGET integrated database retrieval system