Erythranthe guttata (spotted monkey flower): 105954641
Help
Entry
105954641 CDS
T07346
Name
(RefSeq) SKP1-like protein 1A
KO
K03094
S-phase kinase-associated protein 1
Organism
egt
Erythranthe guttata (spotted monkey flower)
Pathway
egt03083
Polycomb repressive complex
egt04120
Ubiquitin mediated proteolysis
egt04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
egt00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
105954641
04120 Ubiquitin mediated proteolysis
105954641
09126 Chromosome
03083 Polycomb repressive complex
105954641
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
egt04131
]
105954641
04121 Ubiquitin system [BR:
egt04121
]
105954641
03036 Chromosome and associated proteins [BR:
egt03036
]
105954641
Membrane trafficking [BR:
egt04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
105954641
Ubiquitin system [BR:
egt04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
105954641
Cul7 complex
105954641
Chromosome and associated proteins [BR:
egt03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
105954641
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
105954641
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Ribosomal_L1
Motif
Other DBs
NCBI-GeneID:
105954641
NCBI-ProteinID:
XP_012833762
LinkDB
All DBs
Position
Unknown
AA seq
169 aa
AA seq
DB search
MSTIDAASEKKICLRSSDGETFEVEESVAVESQTIKHMIEDNCADSCIPLPNVTAKILSR
VLEYCKKHAESVAKSEAEGASTTDKAAADEEIKSYDADFVKVDQATLFDLILAANYLNIR
SLLDLTCQNVADMIKGKTPEEIRKTFNIQNDFTAEEEEEVRRENAWAFE
NT seq
510 nt
NT seq
+upstream
nt +downstream
nt
atgtcgacaatcgacgccgcatctgagaagaagatctgcctgaggagctccgacggcgag
acgttcgaagtggaagagtccgtcgccgtcgagtcgcagacgataaagcacatgatcgag
gacaactgcgccgacagctgcatcccgctccccaacgtcaccgcgaagatcctgtcgagg
gttctcgagtactgcaagaaacacgccgaatccgtcgcgaagtctgaggccgaaggcgcg
tctaccaccgacaaggcggccgccgacgaggagatcaagtcgtacgacgctgatttcgtg
aaggtggatcaggctacgctttttgatttgatattggctgcaaactatctgaacatcaga
agcttgctcgatctgacctgtcaaaatgtggctgacatgatcaaaggtaagacacccgag
gagatacgcaagacattcaacattcaaaatgacttcaccgctgaggaggaagaggaggtc
cgaagggagaatgcttgggcttttgagtga
DBGET
integrated database retrieval system