Erythranthe guttata (spotted monkey flower): 105965074
Help
Entry
105965074 CDS
T07346
Name
(RefSeq) aspartate aminotransferase, mitochondrial
KO
K14455
aspartate aminotransferase, mitochondrial [EC:
2.6.1.1
]
Organism
egt
Erythranthe guttata (spotted monkey flower)
Pathway
egt00220
Arginine biosynthesis
egt00250
Alanine, aspartate and glutamate metabolism
egt00270
Cysteine and methionine metabolism
egt00330
Arginine and proline metabolism
egt00350
Tyrosine metabolism
egt00360
Phenylalanine metabolism
egt00400
Phenylalanine, tyrosine and tryptophan biosynthesis
egt00710
Carbon fixation by Calvin cycle
egt00950
Isoquinoline alkaloid biosynthesis
egt00960
Tropane, piperidine and pyridine alkaloid biosynthesis
egt01100
Metabolic pathways
egt01110
Biosynthesis of secondary metabolites
egt01200
Carbon metabolism
egt01210
2-Oxocarboxylic acid metabolism
egt01230
Biosynthesis of amino acids
Module
egt_M00170
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
egt_M00171
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:
egt00001
]
09100 Metabolism
09102 Energy metabolism
00710 Carbon fixation by Calvin cycle
105965074
09105 Amino acid metabolism
00250 Alanine, aspartate and glutamate metabolism
105965074
00270 Cysteine and methionine metabolism
105965074
00220 Arginine biosynthesis
105965074
00330 Arginine and proline metabolism
105965074
00350 Tyrosine metabolism
105965074
00360 Phenylalanine metabolism
105965074
00400 Phenylalanine, tyrosine and tryptophan biosynthesis
105965074
09110 Biosynthesis of other secondary metabolites
00950 Isoquinoline alkaloid biosynthesis
105965074
00960 Tropane, piperidine and pyridine alkaloid biosynthesis
105965074
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
egt01007
]
105965074
Enzymes [BR:
egt01000
]
2. Transferases
2.6 Transferring nitrogenous groups
2.6.1 Transaminases
2.6.1.1 aspartate transaminase
105965074
Amino acid related enzymes [BR:
egt01007
]
Aminotransferase (transaminase)
Class I
105965074
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Aminotran_1_2
YedD
Motif
Other DBs
NCBI-GeneID:
105965074
NCBI-ProteinID:
XP_012845038
UniProt:
A0A022QPY9
LinkDB
All DBs
Position
Unknown
AA seq
428 aa
AA seq
DB search
MAHLIRVGCSGRLSKYSSVVGATRSMSTAWWRHVEPAPKDPILGVSEAFLADPSPHKVNV
GVGAYRDDNGKPVVLNCVREAERRIGGNLNMEYLPMGGSVKMVEETLKLAYGDNSDLIKD
KRIAAVQALSGTGACRLFADFQKRFSPDSHVYIPVPTWSNHHNIWRDANVPQRTFHYYHP
ETKGLDFASMMDDIKNAPNGSFFLLHACAHNPTGVDPTEEQWKEISYQFKVKGHFAFFDM
AYQGFASGDPERDAKSIRIFLEDGHQIGCSQSYAKNMGLYGQRVGCLSVVCEDEKQAVAV
KSQLQQLARPMYSNPPVHGALIVSTILGDPELKNLWLKEVKGMADRIIGMRTALRENLEN
LGSPLSWEHVTKQIGMFCYSGMTPEQVDRLTNEFHIYMTRNGRISMAGVTTGNVGYLAKA
IHEVTKSS
NT seq
1287 nt
NT seq
+upstream
nt +downstream
nt
atggcgcaccttattcgggtcggttgttcgggtcgactatctaagtactcctccgtggtc
ggagcaacgagatccatgtccacggcgtggtggcgacacgtggagcctgctcccaaggat
ccgatcctcggcgtcagcgaagctttcctcgccgatcctagtccccacaaagtcaatgtc
ggcgttggtgcgtatcgtgatgataatggaaaaccggtggtgctgaattgcgtcagagaa
gccgagagaagaatcggcggcaatttgaacatggaatatcttcccatgggaggaagtgtg
aaaatggtcgaggagaccttaaagctggcttatggtgataattctgatttgattaaagat
aagagaattgcagcagtgcaagctctatcgggaaccggtgcatgcaggctctttgcagac
ttccaaaagcgtttttcccccgattctcatgtctacattccagttcccacctggtccaac
catcacaacatctggagagatgccaatgtcccccagagaacattccactactatcatcca
gaaacgaagggtttggactttgcttcgatgatggatgacataaagaatgcaccaaatgga
tctttctttctgcttcatgcttgtgctcataatccaactggagtggatcctacggaagaa
cagtggaaggagatctcataccagttcaaggtaaaagggcattttgcattctttgacatg
gcatatcaaggttttgctagtggtgatccagaaagggatgccaaatcgattcgcattttt
cttgaggacggacatcagataggatgttctcagtcgtatgcaaagaatatgggactttat
ggccagagagttggttgcctcagtgtggtttgcgaggatgagaaacaggctgtggcagtg
aaaagtcagttacagcagcttgcaagaccaatgtacagtaatccacctgttcatggtgcc
ctcatagtatccaccattcttggtgatcctgagttgaaaaacttgtggctcaaggaagta
aaaggaatggctgatcgcatcattggaatgagaaccgctctacgagaaaatcttgaaaac
ttgggttcgcctctttcatgggagcacgtaacaaagcagattggcatgttttgctatagt
ggaatgacacctgaacaagtagatcgactgactaatgaatttcacatttacatgactcgc
aacggacgcattagtatggctggagtgactacaggcaatgtcggttacttggcaaaagct
atacatgaagtcaccaaatcatcttag
DBGET
integrated database retrieval system