Erythranthe guttata (spotted monkey flower): 105965831
Help
Entry
105965831 CDS
T07346
Name
(RefSeq) SKP1-like protein 14
KO
K03094
S-phase kinase-associated protein 1
Organism
egt
Erythranthe guttata (spotted monkey flower)
Pathway
egt03083
Polycomb repressive complex
egt04120
Ubiquitin mediated proteolysis
egt04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
egt00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
105965831
04120 Ubiquitin mediated proteolysis
105965831
09126 Chromosome
03083 Polycomb repressive complex
105965831
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
egt04131
]
105965831
04121 Ubiquitin system [BR:
egt04121
]
105965831
03036 Chromosome and associated proteins [BR:
egt03036
]
105965831
Membrane trafficking [BR:
egt04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
105965831
Ubiquitin system [BR:
egt04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
105965831
Cul7 complex
105965831
Chromosome and associated proteins [BR:
egt03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
105965831
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
105965831
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Skp1
Motif
Other DBs
NCBI-GeneID:
105965831
NCBI-ProteinID:
XP_012845835
UniProt:
A0A022QQX4
LinkDB
All DBs
Position
Unknown
AA seq
128 aa
AA seq
DB search
MAKENEKINLDESSEISKSTSIAIEDIDRETLAEVTTYLKTRAGKSSNEEKEKSDQEFIS
DKDIHDLLQLLPAVAYLNVTGLREMVEQKIADTMEGKSVAWIREVFGLTNDLDVEDAARQ
MNPWAFND
NT seq
387 nt
NT seq
+upstream
nt +downstream
nt
atggcgaaggaaaacgaaaaaataaatctagatgaaagctctgagatctcgaaatcaaca
tccatcgccatcgaagacatcgacagagaaaccctggcagaggtgaccacatacctgaag
acacgcgccggcaaaagctcgaacgaggagaaagagaagtccgaccaggaatttatttcc
gacaaggatatccatgatctcttacagttgcttccggccgtggcctacctcaacgtaaca
gggttacgggaaatggtagaacagaagatagctgatacgatggagggtaaaagcgtcgct
tggattagggaagttttcggccttacaaacgatttggatgttgaagatgcggccaggcaa
atgaacccctgggctttcaatgattga
DBGET
integrated database retrieval system