Elaeis guineensis (African oil palm): 105032225 Help Entry 105032225         CDS       T03921                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism egu  Elaeis guineensis (African oil palm) Pathway egu04145   Phagocytosis egu04517   IgSF CAM signaling egu04814   Motor proteins Brite KEGG Orthology (KO) [BR:egu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     105032225  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     105032225   09142 Cell motility    04814 Motor proteins     105032225  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:egu03037]     105032225    04812 Cytoskeleton proteins [BR:egu04812]     105032225 Cilium and associated proteins [BR:egu03037]  Motile cilia and associated proteins   Dynein arm    105032225 Cytoskeleton proteins [BR:egu04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      105032225 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  105032225 NCBI-ProteinID:  XP_010904915 UniProt:  A0A6I9Q8D1 LinkDB All DBs Position 2:101817664..101818209 Genome browser AA seq 109 aa AA seqDB search MMERQAVIGEADMLETMQQDALRLAGKALDEFDATNSTQIAHFIKKEFDRSYGPGWQCIV GTDFGSFVTHHSGCFIYFSIGSLAILLFRGGVAPESDRAQLSATDTVKA NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgatggaaagacaggcagtgataggagaggctgacatgctggagaccatgcagcaagat gcactccgcttggctgggaaggccctggatgaatttgatgccacaaactccactcagata gctcatttcatcaagaaggaatttgacaggtcatatggcccagggtggcaatgtattgtg gggactgactttggttcttttgtgacgcaccactctggctgtttcatctacttcagcata ggaagccttgctatcttgctcttcaggggtggagtggctcctgaatcagatagagctcag ttatcagccactgatacagtgaaagcatga

DBGET integrated database retrieval system