Elaeis guineensis (African oil palm): 105035121 Help Entry 105035121         CDS       T03921                                  Name (RefSeq) uncharacterized protein   KO K09481   protein transport protein SEC61 subunit beta Organism egu  Elaeis guineensis (African oil palm) Pathway egu03060   Protein export egu04141   Protein processing in endoplasmic reticulum egu04145   Phagocytosis Brite KEGG Orthology (KO) [BR:egu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     105035121    04141 Protein processing in endoplasmic reticulum     105035121  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     105035121  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:egu04131]     105035121   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:egu02044]     105035121 Membrane trafficking [BR:egu04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     105035121 Secretion system [BR:egu02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    105035121 SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  105035121 NCBI-ProteinID:  XP_010908845 UniProt:  A0A6I9QGK2 LinkDB All DBs Position 10:65635535..65636158 Genome browser AA seq 110 aa AA seqDB search MARGSSQSQTSSSAGGAARPMTVGARGTPAAAAGMRRRRLGGGGGGSAGGGFGGGAAGSN MLRFYTDDAPGLKMTPTVVLVMSLCFIGFVTALHVFGKLYRYRSSATGGS NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggcgaggggaagctcgcagtcgcagacgtcgtcgtccgccgggggcgcggcacggccg atgacggtgggagcacggggaacgccagctgcggcagcaggaatgcggcgacggaggctg ggtggcggcggagggggctccgccggaggaggattcggcggcggggccgcggggagcaac atgctgaggttctacaccgacgacgcacccgggctcaagatgacgcctaccgtcgtgctg gtgatgagcctctgcttcatcggctttgtcactgcgctccacgtcttcggaaagctctac cgctacagatcctccgcaaccgggggttcttga

DBGET integrated database retrieval system