KEGG   Elaeis guineensis (African oil palm): 105042622
Entry
105042622         CDS       T03921                                 
Name
(RefSeq) SKP1-like protein 1A
  KO
K03094  S-phase kinase-associated protein 1
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu03083  Polycomb repressive complex
egu04120  Ubiquitin mediated proteolysis
egu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:egu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105042622
   04120 Ubiquitin mediated proteolysis
    105042622
  09126 Chromosome
   03083 Polycomb repressive complex
    105042622
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:egu04131]
    105042622
   04121 Ubiquitin system [BR:egu04121]
    105042622
   03036 Chromosome and associated proteins [BR:egu03036]
    105042622
Membrane trafficking [BR:egu04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    105042622
Ubiquitin system [BR:egu04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     105042622
   Cul7 complex
     105042622
Chromosome and associated proteins [BR:egu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     105042622
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     105042622
SSDB
Motif
Pfam: Skp1 Skp1_POZ SPP1_GP23-1
Other DBs
NCBI-GeneID: 105042622
NCBI-ProteinID: XP_010918205
UniProt: A0A6I9R5R5
LinkDB
Position
4:complement(133309949..133312486)
AA seq 161 aa
MASAAEIEKKIVLRSSDGVEFEVEEPTARQSKLIGNMIDDGCAENTIPLFNVDAKTLDKV
IEYCRKHAGTTSALGECHNTDKEIESWDAAYIDVDQTILYDILLAANYLDIKALLDLGCE
QVANMMKAKRAEEIRKIFKIKNDFTPEEEEKIQMEYPWAFN
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcgtcggcagctgagatagagaagaagatcgttctaagaagctcagacggcgtggaa
tttgaagtggaggagccaacggcgaggcagtcgaagttgatcggcaacatgatcgacgat
ggctgcgcggagaacacgatccctctcttcaacgtcgatgccaagaccctcgacaaggtg
atcgagtactgcaggaagcatgccggcaccaccagtgcactcggcgaatgccataatacc
gacaaggagatcgagagctgggatgctgcatatattgatgtagatcagaccatcctttat
gacattcttctggctgccaattatctcgatatcaaggctctcttggaccttggatgcgaa
caagtggctaacatgatgaaggcgaagagagcggaggagatccgtaagatttttaaaatt
aagaatgacttcactccagaggaggaggaaaagatccaaatggagtacccgtgggccttc
aactga

DBGET integrated database retrieval system