Elaeis guineensis (African oil palm): 105043996 Help Entry 105043996         CDS       T03921                                  Name (RefSeq) SKP1-like protein 14   KO K03094   S-phase kinase-associated protein 1 Organism egu  Elaeis guineensis (African oil palm) Pathway egu03083   Polycomb repressive complex egu04120   Ubiquitin mediated proteolysis egu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:egu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105043996    04120 Ubiquitin mediated proteolysis     105043996   09126 Chromosome    03083 Polycomb repressive complex     105043996  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:egu04131]     105043996    04121 Ubiquitin system [BR:egu04121]     105043996    03036 Chromosome and associated proteins [BR:egu03036]     105043996 Membrane trafficking [BR:egu04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     105043996 Ubiquitin system [BR:egu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      105043996    Cul7 complex      105043996 Chromosome and associated proteins [BR:egu03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      105043996   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      105043996 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ CobS_N Motif Other DBs NCBI-GeneID:  105043996 NCBI-ProteinID:  XP_010920060 UniProt:  A0A6I9R3Y1 LinkDB All DBs Position 4:9813744..9815094 Genome browser AA seq 162 aa AA seqDB search MADVASTSAVAEAPKTIVLKSSDGEEFEVESLVANQSEMIKGMIDAGCVQSRVPLPNVLG SVLAKVVEYWNRHGGGGKEEEEKQLMEWDKEFAKLDRDELFDLINAASFLNTKPLLDLCC QTVADTIKDMSVPDVRDYFGIESDFTPEEEAKIRNDNKWAYE NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggctgacgtagcgagcaccagcgcggtggcggaggccccaaagacgatcgttctcaag agttccgacggcgaggaattcgaggtggaatcgctggtcgcgaaccagtcggagatgatc aagggcatgatcgacgccgggtgcgtgcagagccgcgtaccccttcccaacgtcctcggc tcggtgctcgccaaggtggtggagtactggaatcgccacggcggtggcggaaaggaggag gaggagaagcagctgatggagtgggacaaggagttcgcgaagctggacagggacgagctg ttcgacctgatcaatgcggccagcttcctcaacaccaagccgctgctcgacctctgctgc cagaccgtggccgataccatcaaggatatgtccgtcccggacgtccgcgactacttcggt atcgagagtgacttcactcccgaagaagaggccaagataaggaatgacaataaatgggcc tacgagtga

DBGET integrated database retrieval system