Elaeis guineensis (African oil palm): 105044041 Help Entry 105044041         CDS       T03921                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism egu  Elaeis guineensis (African oil palm) Pathway egu04145   Phagosome egu04148   Efferocytosis egu04620   Toll-like receptor signaling pathway egu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:egu00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105044041    04148 Efferocytosis     105044041  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105044041  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105044041  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:egu04131]     105044041   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:egu04147]     105044041    04031 GTP-binding proteins [BR:egu04031]     105044041 Membrane trafficking [BR:egu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     105044041  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     105044041   Macropinocytosis    Ras GTPases     105044041  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     105044041 Exosome [BR:egu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105044041   Exosomal proteins of other body fluids (saliva and urine)    105044041   Exosomal proteins of colorectal cancer cells    105044041   Exosomal proteins of bladder cancer cells    105044041 GTP-binding proteins [BR:egu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     105044041 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  105044041 NCBI-ProteinID:  XP_010920122 UniProt:  A0A6I9R406 LinkDB All DBs Position 4:complement(51391018..51406724) Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQYFMDHPGAVPITTAQGEELRKLIGAPIYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKAQKGCSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtcgaggtttataaagtgcgttacggtcggggatggcgccgtcggcaagact tgcatgctgatttcctacacgagcaacacatttcccacggactatgtgccaacagtcttt gacaacttcagtgcgaatgtggtggtagatgggaacactgtgaacctagggttgtgggac actgcaggccaggaggattacaatagactaagacctttgagctatcgtggagctgatgtt tttctcctagccttctcccttatcagtaaggccagctacgagaatgttgctaaaaagtgg attcctgaattgaggcattatgcacctggtgttcctataattcttgttggaacaaagctt gatcttcgggatgataagcagtacttcatggatcatcctggagctgtgcctattactact gctcagggggaagagctgaggaagctaataggtgctcctatctatattgagtgcagttca aagacacagcaaaatgttaaggcagtcttcgatgcagccattaaagttgtacttcagccc cctaagcaaaagaagaagaagaaaagaaaagcacagaagggctgttccattttgtga

DBGET integrated database retrieval system