Elaeis guineensis (African oil palm): 105044220 Help Entry 105044220         CDS       T03921                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism egu  Elaeis guineensis (African oil palm) Pathway egu04145   Phagocytosis egu04517   IgSF CAM signaling egu04814   Motor proteins Brite KEGG Orthology (KO) [BR:egu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     105044220  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     105044220   09142 Cell motility    04814 Motor proteins     105044220  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:egu03037]     105044220    04812 Cytoskeleton proteins [BR:egu04812]     105044220 Cilium and associated proteins [BR:egu03037]  Motile cilia and associated proteins   Dynein arm    105044220 Cytoskeleton proteins [BR:egu04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      105044220 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Orcokinin Motif Other DBs NCBI-GeneID:  105044220 NCBI-ProteinID:  XP_010920350 UniProt:  A0A6I9R4A5 LinkDB All DBs Position 2:112838626..112839403 Genome browser AA seq 93 aa AA seqDB search MLEGKATIQDTDMPLKMQLQAMSSASEALDQFDVSDFRSIAAHIKKEFDMIYGSGWQCVV GSSFGCFFTHTQGTFIYFSLESLNFLIFKGVAA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttggaagggaaagcaacgatccaagacacggatatgccattaaagatgcagctccaa gccatgtcctccgcctcggaagctcttgaccaattcgatgtctcggacttcagaagcatc gctgctcacattaaaaaggaatttgacatgatatatggatccggctggcaatgtgtggtg ggatcaagctttggctgcttctttacccacacgcaagggaccttcatctacttcagcttg gaatctctcaacttcctcatctttaaaggagttgcagcatag

DBGET integrated database retrieval system