Elaeis guineensis (African oil palm): 105044621 Help Entry 105044621         CDS       T03921                                  Name (RefSeq) uncharacterized protein   KO K09481   protein transport protein SEC61 subunit beta Organism egu  Elaeis guineensis (African oil palm) Pathway egu03060   Protein export egu04141   Protein processing in endoplasmic reticulum egu04145   Phagosome Brite KEGG Orthology (KO) [BR:egu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     105044621    04141 Protein processing in endoplasmic reticulum     105044621  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105044621  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:egu04131]     105044621   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:egu02044]     105044621 Membrane trafficking [BR:egu04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     105044621 Secretion system [BR:egu02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    105044621 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  105044621 NCBI-ProteinID:  XP_010920877 UniProt:  A0A6J0PII8 LinkDB All DBs Position 5:5457070..5462683 Genome browser AA seq 105 aa AA seqDB search MARGSSQSQASSNAGGARPVTVGPRGSAAAAAGMRRRRLGSGGASAGGFSGGGSNMLRFY TDEAPGLKMTPTVVLVMSLCFIGFVTALHVFGKLYRYRSAATGGS NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggcgaggggcagttcgcagtcgcaggcgtcgtcgaacgcggggggcgcgcggccggtc actgtggggccgcgggggtcggcggcggccgctgcggggatgcggcggagacggctcggc agcggcggggcttctgctggtgggttctctggcggcgggagcaatatgctgaggttctac actgatgaagccccgggtctcaagatgacgcccaccgtggtcctggtgatgagcctctgc ttcatcggcttcgtcaccgctctccacgtcttcggcaagctctaccgctaccgatccgct gccacaggcggttcttga

DBGET integrated database retrieval system