Elaeis guineensis (African oil palm): 105048291 Help Entry 105048291         CDS       T03921                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism egu  Elaeis guineensis (African oil palm) Pathway egu04145   Phagocytosis egu04517   IgSF CAM signaling egu04814   Motor proteins Brite KEGG Orthology (KO) [BR:egu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     105048291  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     105048291   09142 Cell motility    04814 Motor proteins     105048291  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:egu03037]     105048291    04812 Cytoskeleton proteins [BR:egu04812]     105048291 Cilium and associated proteins [BR:egu03037]  Motile cilia and associated proteins   Dynein arm    105048291 Cytoskeleton proteins [BR:egu04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      105048291 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light CLAMP Motif Other DBs NCBI-GeneID:  105048291 NCBI-ProteinID:  XP_010925860 UniProt:  A0A6I9RNI6 LinkDB All DBs Position 7:complement(95669346..95670286) Genome browser AA seq 97 aa AA seqDB search MLEGKALIQDTDMPKRMQLQAMSCASQALDLFDVADCKNIAAHIKKEFDRRYGPGWQCVV GSNFGCFFTHREGTFIYFCLETLYFLIFKAAAAATPA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgctggaagggaaggcattgatccaggatacggacatgcccaaaaggatgcagctgcag gccatgtcctgtgcctcccaagccctggacctctttgatgtcgccgactgcaagaacatc gccgcccacatcaaaaaggagtttgataggaggtatgggcctggatggcagtgcgtggtg gggtccaacttcgggtgcttcttcacccatagggagggaaccttcatctacttctgcctc gagaccctctacttcctcatcttcaaagctgctgctgctgccactcctgcttag

DBGET integrated database retrieval system