Elaeis guineensis (African oil palm): 105050311 Help Entry 105050311         CDS       T03921                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism egu  Elaeis guineensis (African oil palm) Pathway egu04145   Phagosome egu04148   Efferocytosis egu04517   IgSF CAM signaling egu04518   Integrin signaling egu04620   Toll-like receptor signaling pathway egu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:egu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     105050311    04518 Integrin signaling     105050311  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105050311    04148 Efferocytosis     105050311  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105050311  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105050311  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:egu04131]     105050311   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:egu04147]     105050311    04031 GTP-binding proteins [BR:egu04031]     105050311 Membrane trafficking [BR:egu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     105050311  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     105050311   Macropinocytosis    Ras GTPases     105050311  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     105050311 Exosome [BR:egu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105050311   Exosomal proteins of other body fluids (saliva and urine)    105050311   Exosomal proteins of colorectal cancer cells    105050311   Exosomal proteins of bladder cancer cells    105050311 GTP-binding proteins [BR:egu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     105050311 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU B12-binding Sua5_C Motif Other DBs NCBI-GeneID:  105050311 NCBI-ProteinID:  XP_010928578 UniProt:  A0A6I9RM34 LinkDB All DBs Position 8:10642341..10648336 Genome browser AA seq 213 aa AA seqDB search MASGAPRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGT KLDLREDKYFLSDHPGIMPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAAIKVVI QPPKKQKEKKKKKPQRGCSLLNILYGRKLMCFK NT seq 642 nt NT seq  +upstreamnt  +downstreamnt atggcgtccggcgctccccggttcatcaaatgcgtgacggttggcgatggtgctgtcggg aagacctgcatgcttatctgctacaccagcaacaagttcccgaccgactacattccgacg gtgttcgataacttcagcgccaatgtcgttgttgatggaaccaccgtgaatttaggcctc tgggacactgctgggcaagaggattacaatagattgaggccgttgagctatcgaggggcg gatgtttttgtgctggctttctcgctggtgagccgagcgagctatgaaaatgttctgaag aagtggatacccgagcttcagcattatgcaccgggagtccccgtggtgctggtcggcacc aaattggatcttcgtgaagataaatatttcctatcagaccatcctggtattatgcctgtt accactgctcagggagaggaactccgaaagcaaataggtgctgcgtattatatagagtgt agctcaaaaacacaacagaatgtcaaagcagtgtttgatgctgccatcaaggtagttatt cagcctccaaaaaaacagaaggagaagaagaagaaaaagccacagcgtggatgttcacta ttgaatatcctttatgggaggaagcttatgtgctttaaataa

DBGET integrated database retrieval system