Elaeis guineensis (African oil palm): 105053523 Help Entry 105053523         CDS       T03921                                  Name (RefSeq) uncharacterized protein   KO K03505   DNA polymerase delta subunit 4 Organism egu  Elaeis guineensis (African oil palm) Pathway egu03030   DNA replication egu03410   Base excision repair egu03420   Nucleotide excision repair egu03430   Mismatch repair egu03440   Homologous recombination Brite KEGG Orthology (KO) [BR:egu00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     105053523    03410 Base excision repair     105053523    03420 Nucleotide excision repair     105053523    03430 Mismatch repair     105053523    03440 Homologous recombination     105053523  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:egu03032]     105053523    03400 DNA repair and recombination proteins [BR:egu03400]     105053523 DNA replication proteins [BR:egu03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     105053523 DNA repair and recombination proteins [BR:egu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       105053523    MMR (mismatch excision repair)     DNA polymerase delta complex      105053523 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  105053523 NCBI-ProteinID:  XP_010933033 UniProt:  A0A6I9RVG5 LinkDB All DBs Position 11:6962733..6963651 Genome browser AA seq 137 aa AA seqDB search MASGDIQDFYRQRKKGAAASAATAKKKSGKPRRGGATVGADAAQTPFIVSHGSPDLQDDY GPEEEKLRQFDMDMRYGPCLGLTRLQRWERASAMGLHPPPEVGELLRQMWQDELRRRSSE PKTKPNPVLECLWEGRV NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atggcatcgggcgacatccaggacttctaccggcaaaggaagaagggcgccgccgcctct gccgccaccgccaaaaagaaatccggaaagccccgacgcggcggcgccaccgtgggagct gacgcggcccagacccctttcatcgtctcccacggatcccccgatctccaagatgattac gggccagaggaggagaagctccggcagttcgacatggacatgaggtacggaccctgcctc ggccttacccgcctccagcgctgggagcgcgcctccgccatgggcctccacccgccgccg gaagtcggcgagctcctccgccaaatgtggcaggacgagctccgccgccgatcgtcggag ccaaagactaagcctaaccccgtgctggagtgcctctgggagggccgagtctag

DBGET integrated database retrieval system