Elaeis guineensis (African oil palm): 105059462 Help Entry 105059462         CDS       T03921                                  Name (RefSeq) uncharacterized protein   KO K03505   DNA polymerase delta subunit 4 Organism egu  Elaeis guineensis (African oil palm) Pathway egu03030   DNA replication egu03410   Base excision repair egu03420   Nucleotide excision repair egu03430   Mismatch repair egu03440   Homologous recombination Brite KEGG Orthology (KO) [BR:egu00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     105059462    03410 Base excision repair     105059462    03420 Nucleotide excision repair     105059462    03430 Mismatch repair     105059462    03440 Homologous recombination     105059462  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:egu03032]     105059462    03400 DNA repair and recombination proteins [BR:egu03400]     105059462 DNA replication proteins [BR:egu03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     105059462 DNA repair and recombination proteins [BR:egu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       105059462    MMR (mismatch excision repair)     DNA polymerase delta complex      105059462 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  105059462 NCBI-ProteinID:  XP_010941060 UniProt:  A0A6I9SD67 LinkDB All DBs Position 16:complement(34145430..34146199) Genome browser AA seq 110 aa AA seqDB search MASVGGIKGFYREKKKGGVTKPSPKPHSAADRASSSTLRSSDVQEQEKEAEERLRQFDMD MRYGPCLGLTRMERWDRAAAMGLNPPPEVEAILLKCSSTAALECLWEGRV NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggcgtcggtcggtggaatcaagggcttctaccgcgagaagaagaaaggtggagtgacg aagccctcccctaagccgcattccgccgccgatcgggcctcctcttccactctcaggtcc tccgacgtccaagagcaagagaaggaggcggaggagaggctgaggcagttcgacatggac atgaggtacgggccatgccttggtctcacccggatggagcgctgggaccgggcggccgcc atgggcctcaacccgccgcctgaagtggaggccatcctcctcaagtgctcctccaccgcg gctctcgagtgcctctgggagggccgcgtctaa

DBGET integrated database retrieval system