Elaeis guineensis (African oil palm): 105059642 Help Entry 105059642         CDS       T03921                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism egu  Elaeis guineensis (African oil palm) Pathway egu04145   Phagosome egu04148   Efferocytosis egu04620   Toll-like receptor signaling pathway egu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:egu00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105059642    04148 Efferocytosis     105059642  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105059642  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105059642  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:egu04131]     105059642   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:egu04147]     105059642    04031 GTP-binding proteins [BR:egu04031]     105059642 Membrane trafficking [BR:egu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     105059642  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     105059642   Macropinocytosis    Ras GTPases     105059642  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     105059642 Exosome [BR:egu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105059642   Exosomal proteins of other body fluids (saliva and urine)    105059642   Exosomal proteins of colorectal cancer cells    105059642   Exosomal proteins of bladder cancer cells    105059642 GTP-binding proteins [BR:egu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     105059642 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  105059642 NCBI-ProteinID:  XP_010941321 UniProt:  A0A6I9SC89 LinkDB All DBs Position 16:20179225..20187381 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELRKAIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKRKGQMACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcatcgaggttcataaagtgtgtcacggtgggggacggcgccgtcggcaagacc tgcatgcttatatcctacaccagcaacactttccccacggattatgttccaacagttttc gacaatttcagtgcaaatgttgtggtggatggtagcactgttaacctaggtttgtgggac actgcaggccaggaggattataatagattaagacctttgagctatcgtggggctgatgtt tttttgctggcattctctctcatcagtaaggccagctatgaaaatgttgctaagaagtgg attcctgaactgaggcactacgcaccaggtgtgcctataattcttgttgggaccaagctt gatcttcgggatgataagcaattttttatagatcacccaggtgctgttcccattactact gctcagggagaagagctgaggaaggcaataggggctcctgcctacatcgagtgcagttca aagacccaacaaaacgtcaaggcagtttttgatgcagccattaaggtggtactccagcct cccaagcagaagaaaaagaagaggaagggacagatggcttgctccattttgtga

DBGET integrated database retrieval system