Elaeis guineensis (African oil palm): 105059642 Help Entry 105059642         CDS       T03921                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism egu  Elaeis guineensis (African oil palm) Pathway egu04145   Phagosome egu04148   Efferocytosis egu04517   IgSF CAM signaling egu04518   Integrin signaling egu04620   Toll-like receptor signaling pathway egu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:egu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     105059642    04518 Integrin signaling     105059642  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105059642    04148 Efferocytosis     105059642  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105059642  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105059642  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:egu04131]     105059642   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:egu04147]     105059642    04031 GTP-binding proteins [BR:egu04031]     105059642 Membrane trafficking [BR:egu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     105059642  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     105059642   Macropinocytosis    Ras GTPases     105059642  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     105059642 Exosome [BR:egu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105059642   Exosomal proteins of other body fluids (saliva and urine)    105059642   Exosomal proteins of colorectal cancer cells    105059642   Exosomal proteins of bladder cancer cells    105059642 GTP-binding proteins [BR:egu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     105059642 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  105059642 NCBI-ProteinID:  XP_010941322 UniProt:  A0A6I9SC89 LinkDB All DBs Position 16:38958300..38966512 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELRKAIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKRKGQMACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcatcgaggttcataaagtgtgtcacggtgggggacggcgccgtcggcaagacc tgcatgcttatatcctacaccagcaacactttccccacggattatgttccaacagttttc gacaatttcagtgcaaatgttgtggtggatggtagcactgttaacctaggtttgtgggac actgcaggccaggaggattataatagattaagacctttgagctatcgtggggctgatgtt tttttgctggcattctctctcatcagtaaggccagctatgaaaatgttgctaagaagtgg attcctgaactgaggcactacgcaccaggtgtgcctataattcttgttgggaccaagctt gatcttcgggatgataagcaattttttatagatcacccaggtgctgttcccattactact gctcagggagaagagctgaggaaggcaataggggctcctgcctacatcgagtgcagttca aagacccaacaaaacgtcaaggcagtttttgatgcagccattaaggtggtactccagcct cccaagcagaagaaaaagaagaggaagggacagatggcttgctccattttgtga

DBGET integrated database retrieval system