Elaeis guineensis (African oil palm): 140856134 Help Entry 140856134         CDS       T03921                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism egu  Elaeis guineensis (African oil palm) Pathway egu04145   Phagocytosis egu04517   IgSF CAM signaling egu04814   Motor proteins Brite KEGG Orthology (KO) [BR:egu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     140856134  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     140856134   09142 Cell motility    04814 Motor proteins     140856134  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:egu03037]     140856134    04812 Cytoskeleton proteins [BR:egu04812]     140856134 Cilium and associated proteins [BR:egu03037]  Motile cilia and associated proteins   Dynein arm    140856134 Cytoskeleton proteins [BR:egu04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      140856134 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  140856134 NCBI-ProteinID:  XP_073109399 UniProt:  A0ACM7C829 LinkDB All DBs Position 3:complement(112939024..112939621) Genome browser AA seq 98 aa AA seqDB search MLDGKASIQDTDMPVKMQLQARSCAAQALDLFDVLDCKSIAGATHIKKEFNMRHGPGWHC VVGSNFGCFFTHRRGTFIYFCLETLFFLIFKAAALTPV NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgttggacgggaaggcatcgatccaggataccgacatgcccgtaaagatgcagctgcag gccaggtcctgcgccgcccaagccctcgacctctttgatgtcctcgattgcaaaagcatc gccggcgccactcacatcaaaaaggagtttaacatgaggcatgggcccggatggcattgc gtggtgggttccaacttcggctgcttcttcacccacaggcgaggcaccttcatctacttc tgcctcgagacactcttcttcctcatcttcaaagctgctgctcttactcctgtttag

DBGET integrated database retrieval system