Elaeis guineensis (African oil palm): 140856607 Help Entry 140856607         CDS       T03921                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism egu  Elaeis guineensis (African oil palm) Pathway egu04145   Phagocytosis egu04517   IgSF CAM signaling egu04814   Motor proteins Brite KEGG Orthology (KO) [BR:egu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     140856607  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     140856607   09142 Cell motility    04814 Motor proteins     140856607  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:egu03037]     140856607    04812 Cytoskeleton proteins [BR:egu04812]     140856607 Cilium and associated proteins [BR:egu03037]  Motile cilia and associated proteins   Dynein arm    140856607 Cytoskeleton proteins [BR:egu04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      140856607 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  140856607 NCBI-ProteinID:  XP_073110559 UniProt:  A0ACM7C829 LinkDB All DBs Position 3:complement(112919840..112921988) Genome browser AA seq 98 aa AA seqDB search MLDGKASIQDTDMPVKMQLQARSCAAQALDLFDVLDCKSIAGATHIKKEFNMRHGPGWHC VVGSNFGCFFTHRRGTFIYFCLETLFFLIFKAAALTPV NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgttggacgggaaggcatcgatccaggataccgacatgcccgtaaagatgcagctgcag gccaggtcctgcgccgcccaagccctcgacctctttgatgtcctcgattgcaaaagcatc gccggcgccactcacatcaaaaaggagtttaacatgaggcatgggcccggatggcattgc gtggtgggttccaacttcggctgcttcttcacccacaggcgaggcaccttcatctacttc tgcctcgagacactcttcttcctcatcttcaaagctgctgctcttactcctgtttag

DBGET integrated database retrieval system