Egretta garzetta (little egret): 104122300 Help Entry 104122300         CDS       T05152                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism egz  Egretta garzetta (little egret) Pathway egz04810   Regulation of actin cytoskeleton egz05132   Salmonella infection Brite KEGG Orthology (KO) [BR:egz00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104122300 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104122300 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:egz04131]     104122300 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:egz04812]     104122300 (PFN2)    04147 Exosome [BR:egz04147]     104122300 (PFN2) Membrane trafficking [BR:egz04131]  Others   Actin-binding proteins    Others     104122300 (PFN2) Cytoskeleton proteins [BR:egz04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      104122300 (PFN2) Exosome [BR:egz04147]  Exosomal proteins   Proteins found in most exosomes    104122300 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  104122300 NCBI-ProteinID:  XP_009632700 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRV LVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgattgtaggaaaagaccgggagggtttcttcaccaatggtctgacccttggtgcaaag aagtgctctgtgatcagagatagcctgtatgttgatggtgactgcacaatggacatcagg acaaagagtcaaggtggtgagccaacgtacaatgttgctgtaggcagagctggccgagtc ttggtctttgtaatgggcaaagaaggggtccatggaggcggattgaataagaaggcatac tcaatggcaaaatacttgagagactctgggttctag

DBGET integrated database retrieval system