Egretta garzetta (little egret): 104124907 Help Entry 104124907         CDS       T05152                                  Symbol INS Name (RefSeq) insulin isoform X1   KO K04526   insulin Organism egz  Egretta garzetta (little egret) Pathway egz04010   MAPK signaling pathway egz04068   FoxO signaling pathway egz04081   Hormone signaling egz04114   Oocyte meiosis egz04140   Autophagy - animal egz04150   mTOR signaling pathway egz04810   Regulation of actin cytoskeleton egz04910   Insulin signaling pathway egz04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:egz00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104124907 (INS)    04068 FoxO signaling pathway     104124907 (INS)    04150 mTOR signaling pathway     104124907 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     104124907 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104124907 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     104124907 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104124907 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     104124907 (INS)    04914 Progesterone-mediated oocyte maturation     104124907 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:egz04052]     104124907 (INS) Cytokines and neuropeptides [BR:egz04052]  Neuropeptides   Unclassified    104124907 (INS) SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  104124907 NCBI-ProteinID:  XP_009635579 UniProt:  A0A091JSW1 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MGLLLPTTQPPSLRANYFPSFAATSLGLTLLTMALWIRSLPLLALLALSSPGTSHAAANQ HLCGSHLVEALYLVCGERGFFYSPKARRDVEQPLVSGPLHGEVGELPFQQAEFEKVKRGI VEQCCHNTCSLYQLENYCN NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atggggctattactaccaaccacacagcctccatctctcagagcaaactactttccatct tttgctgccacttccttgggcctcaccctgctcaccatggctctctggatccgatcgctg cctctcctggcccttctcgctctttccagccctgggaccagccacgcagctgccaaccag cacctctgtggctcccacttggtggaggctctctatctggtgtgtggagagaggggtttc ttctactcccccaaagcccgacgggatgttgagcagcctctagtgagcggtcccttacac ggtgaggtaggcgagctgccctttcagcaggcggagtttgagaaagtgaagcgagggatc gttgagcaatgctgccacaacacgtgctccctctaccaactggaaaactactgcaactag

DBGET integrated database retrieval system