Egretta garzetta (little egret): 104126779 Help Entry 104126779         CDS       T05152                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism egz  Egretta garzetta (little egret) Pathway egz04010   MAPK signaling pathway egz04012   ErbB signaling pathway egz04068   FoxO signaling pathway egz04137   Mitophagy - animal egz04140   Autophagy - animal egz04150   mTOR signaling pathway egz04210   Apoptosis egz04218   Cellular senescence egz04370   VEGF signaling pathway egz04371   Apelin signaling pathway egz04540   Gap junction egz04625   C-type lectin receptor signaling pathway egz04810   Regulation of actin cytoskeleton egz04910   Insulin signaling pathway egz04912   GnRH signaling pathway egz04916   Melanogenesis Brite KEGG Orthology (KO) [BR:egz00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104126779 (NRAS)    04012 ErbB signaling pathway     104126779 (NRAS)    04370 VEGF signaling pathway     104126779 (NRAS)    04371 Apelin signaling pathway     104126779 (NRAS)    04068 FoxO signaling pathway     104126779 (NRAS)    04150 mTOR signaling pathway     104126779 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104126779 (NRAS)    04137 Mitophagy - animal     104126779 (NRAS)   09143 Cell growth and death    04210 Apoptosis     104126779 (NRAS)    04218 Cellular senescence     104126779 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     104126779 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104126779 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104126779 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104126779 (NRAS)    04912 GnRH signaling pathway     104126779 (NRAS)    04916 Melanogenesis     104126779 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:egz04131]     104126779 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:egz04147]     104126779 (NRAS)    04031 GTP-binding proteins [BR:egz04031]     104126779 (NRAS) Membrane trafficking [BR:egz04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104126779 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104126779 (NRAS) Exosome [BR:egz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104126779 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    104126779 (NRAS)   Exosomal proteins of breast cancer cells    104126779 (NRAS)   Exosomal proteins of colorectal cancer cells    104126779 (NRAS) GTP-binding proteins [BR:egz04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104126779 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc FeoB_N RsgA_GTPase GTP_EFTU Arf IL23 Motif Other DBs NCBI-GeneID:  104126779 NCBI-ProteinID:  XP_009637677 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVD TKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNEDGNQGCMGLSC IMM NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgcgtgatcagtacatgagaactggggaaggattcctctgtgtttttgccattaacaac agtaaatcatttgctgatattaacctttacagagaacagatcaagagagtgaaagattca gatgacgtgccaatggtgctagttgggaataagtgtgatttgcccacaagaacagtagac acaaaacaggctcaagaattggcaaaaagctatggaatccccttcatagagacatctgct aaaacaagacagggtgtggaagacgctttttacacactggtgagagagatccggcagtac cggatgaaaaagctcaacagcaatgaagatgggaatcaaggctgtatgggattgtcttgc attatgatgtga

DBGET integrated database retrieval system