Egretta garzetta (little egret): 104127229 Help Entry 104127229         CDS       T05152                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism egz  Egretta garzetta (little egret) Brite KEGG Orthology (KO) [BR:egz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:egz03036]     104127229   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:egz04147]     104127229 Chromosome and associated proteins [BR:egz03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104127229 Exosome [BR:egz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104127229 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  104127229 NCBI-ProteinID:  XP_035751289 LinkDB All DBs Position Unknown AA seq 86 aa AA seqDB search ATRRSQKATERLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL CAIHAKRVTIMPKDIQLARRIRGERA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gcgacccggcgctcccagaaggcgacggagcggctgatccgcaagctgcccttccagcgg ctggtgcgcgagatcgcgcaggacttcaagacggacctgcgcttccagagctcggccgtg atggcgctgcaggaggcgagcgaggcctacctggtggggctcttcgaggacaccaacctc tgcgccatccacgccaagcgcgtcaccatcatgcccaaggacatccagctggcccggcgc atccgcggcgagcgcgcctga

DBGET integrated database retrieval system