Egretta garzetta (little egret): 104127694 Help Entry 104127694         CDS       T05152                                  Name (RefSeq) tubulin beta chain   KO K07375   tubulin beta Organism egz  Egretta garzetta (little egret) Pathway egz04145   Phagosome egz04517   IgSF CAM signaling egz04540   Gap junction egz04814   Motor proteins egz05132   Salmonella infection Brite KEGG Orthology (KO) [BR:egz00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     104127694  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     104127694   09144 Cellular community - eukaryotes    04540 Gap junction     104127694   09142 Cell motility    04814 Motor proteins     104127694  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104127694  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:egz03036]     104127694   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:egz04812]     104127694    04147 Exosome [BR:egz04147]     104127694 Chromosome and associated proteins [BR:egz03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      104127694 Cytoskeleton proteins [BR:egz04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     104127694 Exosome [BR:egz04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104127694   Exosomal proteins of colorectal cancer cells    104127694   Exosomal proteins of bladder cancer cells    104127694 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tubulin Tubulin_3 Tubulin_2 TrmK Motif Other DBs NCBI-GeneID:  104127694 NCBI-ProteinID:  XP_035751785 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQG FQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEP NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atggactcggtgcgctccggcccctttggacagatcttccgtcccgacaactttgtcttt ggtcagagcggggctggcaacaactgggccaagggtcactacacggaaggcgccgagctg gtggactctgtcctggatgtggtgaggaaggagtcggagagctgtgactgcctccagggc ttccagttgacccactcgctgggcggcggcacgggctctggcatgggcaccctcctcatc agcaagatccgcgaggagtaccccgaccgcatcatgaacaccttcagcgtcatgccctcg cccaaggtgtcggacacggtggtggagccc

DBGET integrated database retrieval system