Egretta garzetta (little egret): 104127742 Help Entry 104127742         CDS       T05152                                  Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism egz  Egretta garzetta (little egret) Pathway egz04060   Cytokine-cytokine receptor interaction egz04218   Cellular senescence egz04620   Toll-like receptor signaling pathway egz04621   NOD-like receptor signaling pathway egz04622   RIG-I-like receptor signaling pathway egz05132   Salmonella infection egz05164   Influenza A Brite KEGG Orthology (KO) [BR:egz00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104127742  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     104127742  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104127742    04621 NOD-like receptor signaling pathway     104127742    04622 RIG-I-like receptor signaling pathway     104127742  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104127742   09171 Infectious disease: bacterial    05132 Salmonella infection     104127742  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:egz04052]     104127742    00536 Glycosaminoglycan binding proteins [BR:egz00536]     104127742 Cytokines and neuropeptides [BR:egz04052]  Cytokines   Chemokines    104127742 Glycosaminoglycan binding proteins [BR:egz00536]  Heparan sulfate / Heparin   Chemokines    104127742 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  104127742 NCBI-ProteinID:  XP_035751847 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MMGKAVAVVLTLLLISAVGTKGKALPRSAIELRCQCIGTHSKFIHPKFIHNVNLIPSGPH CKNVEVIATLSDGREVCLEPTAPWVKLIIKAILDK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgatgggcaaggctgtggctgttgtcctgacccttctcctgatctcagcggttggaaca aaaggtaaggccctgccacgctcagcgattgaactccggtgccagtgcataggcacccat tccaagttcatccatcccaagttcatccataacgtgaacctcatccccagtggacctcac tgcaagaacgttgaagtcatagctaccctgtcagatggcagagaagtgtgcctggagccc accgctccctgggtgaagctgatcatcaaggcaattctggacaagtga

DBGET integrated database retrieval system