Egretta garzetta (little egret): 104128849 Help Entry 104128849         CDS       T05152                                  Name (RefSeq) histone H2A-IV   KO K11251   histone H2A Organism egz  Egretta garzetta (little egret) Pathway egz03082   ATP-dependent chromatin remodeling egz04217   Necroptosis Brite KEGG Orthology (KO) [BR:egz00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     104128849  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     104128849  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:egz03036]     104128849   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:egz04147]     104128849 Chromosome and associated proteins [BR:egz03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104128849 Exosome [BR:egz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104128849 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone Motif Other DBs NCBI-GeneID:  104128849 NCBI-ProteinID:  XP_009639992 UniProt:  A0A091JES5 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search NYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLL GKVTIAQGGVLPNIQAVLLPKKTDSHKAKAK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt aactacgcggagcgggtgggcgccggcgccccggtgtacctggcggccgtgctggagtac ctgacggccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgc atcatcccccggcacctgcagctggccatccgcaacgacgaggagctcaacaagctgctg ggcaaggtgacgatcgcgcagggcggggtgctgcccaacatccaggccgtcctgctgccc aagaagaccgacagccacaaggctaaagccaagtga

DBGET integrated database retrieval system