Egretta garzetta (little egret): 104129448 Help Entry 104129448         CDS       T05152                                  Symbol FGF20 Name (RefSeq) fibroblast growth factor 20   KO K04358   fibroblast growth factor Organism egz  Egretta garzetta (little egret) Pathway egz04010   MAPK signaling pathway egz04020   Calcium signaling pathway egz04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:egz00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104129448 (FGF20)    04020 Calcium signaling pathway     104129448 (FGF20)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104129448 (FGF20)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:egz04052]     104129448 (FGF20)    00536 Glycosaminoglycan binding proteins [BR:egz00536]     104129448 (FGF20) Cytokines and neuropeptides [BR:egz04052]  Cytokines   Growth factors (RTK binding)    104129448 (FGF20) Glycosaminoglycan binding proteins [BR:egz00536]  Heparan sulfate / Heparin   Growth factors/receptors    104129448 (FGF20) SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  104129448 NCBI-ProteinID:  XP_009640672 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MCSGILEFISVAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTSECIFREQFEENWYNTYS SNVYKHGDSGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDVLGYS NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtgttcaggtatccttgagttcatcagtgtggcagtgggcctggtcagtattagaggc gtggacagtggcctttaccttgggatgaacgagaagggagaactctatggctcagagaaa ctaacttctgaatgcatcttcagggaacagtttgaggaaaactggtacaacacttactcg tccaatgtgtacaaacatggagattcggggcggcgatacttcgtagcacttaacaaagac ggtactcctagagatggggcaaggtccaaaagacaccagaaattcacacatttcttgccc cggcctgtggatcctgaaagagttccagaactgtacaaagatgtgttaggatacagctga

DBGET integrated database retrieval system