Egretta garzetta (little egret): 104131731 Help Entry 104131731         CDS       T05152                                  Name (RefSeq) claudin-19   KO K06087   claudin Organism egz  Egretta garzetta (little egret) Pathway egz03272   Virion - Hepatitis viruses egz04382   Cornified envelope formation egz04514   Cell adhesion molecule (CAM) interaction egz04530   Tight junction Brite KEGG Orthology (KO) [BR:egz00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     104131731  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     104131731  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     104131731  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     104131731  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:egz03037]     104131731    04147 Exosome [BR:egz04147]     104131731 Cilium and associated proteins [BR:egz03037]  Other cilia and associated proteins   Stereociliary proteins    104131731 Exosome [BR:egz04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    104131731   Exosomal proteins of colorectal cancer cells    104131731 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Amastin SUR7 Motif Other DBs NCBI-GeneID:  104131731 NCBI-ProteinID:  XP_009643232 LinkDB All DBs Position Unknown AA seq 172 aa AA seqDB search MGTSTLGMCIAPVAFRDCGAPVAHIQTSRALMVISLLLGFFGIIVSVVGMKCTKVGEEDP VTKSRIAVAGGVLFVLSGLCTLAAVSLYATQVTYEFFRESTIPINARYEFGSALFIGWGA ASLTVLGGSLLCCSCPTKERQGQQYYRQSQPSTAREPPVKMSSSPIRGEQCL NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atggggacatcaaccctgggaatgtgcatcgcccctgtggcatttagagactgtggtgcc cctgtggctcacatccagacctcccgggctctcatggtgatttctctcctcctgggcttc ttcggcatcatcgtgagcgtggtgggcatgaaatgcaccaaagttggtgaagaggatccc gttaccaagagccgcatagctgttgccggtggtgtcctctttgtcctctctggtctgtgc acgttggccgccgtgtccttatatgcaacacaggtgacctacgagttcttcagggagagc accatccccatcaacgccaggtacgaattcggctcggctctcttcatcggctggggggcc gccagcctcaccgtgctggggggctccctcctgtgctgctcctgccccaccaaggagcgg caaggacagcagtactaccggcagtcacagccttcgacggctcgggaaccccctgtaaaa atgtcttcttcacccatcaggggagagcagtgcttgtag

DBGET integrated database retrieval system