Egretta garzetta (little egret): 104131756 Help Entry 104131756         CDS       T05152                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism egz  Egretta garzetta (little egret) Pathway egz03410   Base excision repair egz04140   Autophagy - animal egz04217   Necroptosis Brite KEGG Orthology (KO) [BR:egz00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     104131756 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104131756 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     104131756 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:egz03036]     104131756 (HMGB1)    03400 DNA repair and recombination proteins [BR:egz03400]     104131756 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:egz04147]     104131756 (HMGB1) Chromosome and associated proteins [BR:egz03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     104131756 (HMGB1) DNA repair and recombination proteins [BR:egz03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      104131756 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      104131756 (HMGB1) Exosome [BR:egz04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104131756 (HMGB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 RNA_pol_3_Rpc31 HMG_box_5 Motif Other DBs NCBI-GeneID:  104131756 NCBI-ProteinID:  XP_009643258 UniProt:  A0A091IR01 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSSKEKGKF EDMAKADKLRYEKEMKNYVPPKGETKKKFKDPNAPKRPPSAFFLFCSEFRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKVDAGKKVVAKAEK SKKKKEEEEDEDEDEEDEDDEEEEEEEDEDDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggcgatcctaagaagccgagaggtaaaatgtcttcatacgccttctttgtg caaacctgccgggaggagcacaagaagaaacatccagatgcttcagtgaacttttcagag ttctcaaaaaaatgctcagaacgatggaagactatgtcttctaaggagaaagggaagttt gaagatatggcaaaggctgacaagcttcgttatgaaaaagaaatgaaaaactatgtacca ccgaagggggaaacaaaaaagaagttcaaggatccaaatgcaccgaagaggcctccttcg gcttttttcttgttttgctctgagtttcgtccaaaaatcaaaggagaacatcctggtctg tccattggggacgtcgcaaagaaactgggagagatgtggaacaacaccgctgcagatgac aaacagccttatgaaaaaaaggctgctaaactgaaggagaagtatgaaaaggatattgct gcataccgggccaaagggaaggttgatgcaggcaaaaaagtagttgccaaggctgagaag agcaagaagaagaaggaggaggaagaagatgaggatgaagacgaagaggatgaagatgat gaagaagaggaagaggaggaggatgaagatgatgatgatgacgaataa

DBGET integrated database retrieval system