KEGG   Egretta garzetta (little egret): 104133144
Entry
104133144         CDS       T05152                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104133144 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:egz04050]
    104133144 (TNFRSF8)
   04090 CD molecules [BR:egz04090]
    104133144 (TNFRSF8)
Cytokine receptors [BR:egz04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   104133144 (TNFRSF8)
CD molecules [BR:egz04090]
 Proteins
  104133144 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 104133144
NCBI-ProteinID: XP_009644811
LinkDB
Position
Unknown
AA seq 466 aa
MLLWVNTELSLEVQAPYRTTQTTGIHPSNFDIYQTSLTPSHSCDTLENWLYDETSQSCCY
QCPSGYVKKKACPKDPGKDCMRCGPEQYVNEEFQKPRCDACVSCAKESDLVEKEPCSFNS
SRVCECRPGLFCQTPVLNTCIRCQQHTVCKPGFGVKVRGTSTNDVICEECPSGTFSDQNS
STDICKPHTNCARLNKIALREGNATHDQVCLDQLPTYLTPSTFSMRFSNETNNSNLRRSE
DNLVTTASSTPEEETLTHTFPTSAKGEMTTGGLVLWRVVLSVIVLLVGMLLFWKWKVCKK
RILILKGPSSDPVNKYAKIIPTTDSGPEKELIDRTPPVETNNNLVSSTEKAYSPDLSLTD
VAQSNGNSPDCPIDSRVRDHTNNRIEKIYIMKADTVIVGSISEVPSGKNCAARGCESNVD
AQESIEEELGMHYPEQETESFSGNDVMVPVEEEGKEFHHPTTATEK
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgttgctgtgggttaatacagagttgagcctggaggtccaagctccgtaccgcactact
cagacaacaggaattcacccaagtaattttgatatttaccagacatcattaaccccatct
cattcctgtgatacacttgagaattggttgtatgatgaaacttcacaaagctgctgttat
cagtgtccctcaggctatgttaagaagaaagcatgtcctaaggacccaggtaaagactgc
atgagatgtggacctgaacaatatgtgaatgaagaattccaaaagccacgatgtgatgct
tgtgtatcatgcgcaaaagaatctgaccttgtggagaaagagccctgctccttcaattct
agccgcgtgtgtgagtgccgaccaggtctgttctgtcaaacccctgttctgaacacctgc
atacgatgccagcagcacactgtttgcaagcctggttttggagtcaaagtcagaggcact
tcaacaaatgatgttatttgtgaggagtgcccttctgggaccttctctgatcaaaactcc
agcactgacatctgcaagccccacacgaactgtgccaggttaaacaaaatagcactaagg
gaaggaaatgccacacacgatcaggtttgcctggaccaactgcccacctaccttactcca
agcactttttccatgagattcagcaatgaaacaaataactctaacctaaggaggtctgag
gataacctggtgaccactgctagttcaactcctgaggaggaaactctgactcacactttt
cccacctcagccaagggggagatgacaacgggaggtctggttctttggagagtggttctc
tctgtgatagtgctacttgtgggcatgctgttattttggaaatggaaggtttgcaagaag
cggatcctcatcctcaaaggaccaagttctgatccagtgaacaaatatgcaaagatcata
ccgactactgacagtggaccagaaaaggaattaattgacagaacccctcctgtggaaacc
aacaataacttggtctccagcacagaaaaagcatatagtcctgatctgagtctgactgac
gtggcacagagcaatggaaattccccagactgccctatcgattctcgagtgagagaccac
acaaataatcgaattgaaaaaatatacatcatgaaggccgacactgttattgtggggtcc
atttcagaagtgcctagtggcaagaactgtgctgctagaggatgtgaaagtaatgttgat
gcccaggaaagcatagaagaagagctgggaatgcactatccagagcaggaaacagaatct
ttttccgggaatgatgtaatggttcccgtggaagaggagggaaaggaatttcatcacccc
accactgccactgaaaagtga

DBGET integrated database retrieval system