Egretta garzetta (little egret): 104134586 Help Entry 104134586         CDS       T05152                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism egz  Egretta garzetta (little egret) Brite KEGG Orthology (KO) [BR:egz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:egz03036]     104134586   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:egz04147]     104134586 Chromosome and associated proteins [BR:egz03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104134586 Exosome [BR:egz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104134586 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  104134586 NCBI-ProteinID:  XP_035759535 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MLSNTNSFFFFLLFDFKRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRF QSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgctttcaaatactaattctttcttcttctttctgttatttgattttaaaaggccgggt accgtggctctccgtgaaatcaggcgctatcaaaagtctaccgaacttttgatccgcaaa cttcccttccagcgcctggtgcgtgaaattgctcaggacttcaaaacagatctgcgcttc cagagcgctgccatcggtgctttgcaggaggcaagtgaagcttacttggttggcctgttt gaagataccaacctgtgtgctatccatgccaaacgtgtcacaatcatgccaaaagatatc cagctagcacgccgcatacgtggagagcgtgcctaa

DBGET integrated database retrieval system