Egretta garzetta (little egret): 118452301 Help Entry 118452301         CDS       T05152                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism egz  Egretta garzetta (little egret) Pathway egz04020   Calcium signaling pathway egz04070   Phosphatidylinositol signaling system egz04114   Oocyte meiosis egz04218   Cellular senescence egz04261   Adrenergic signaling in cardiomyocytes egz04270   Vascular smooth muscle contraction egz04371   Apelin signaling pathway egz04625   C-type lectin receptor signaling pathway egz04744   Phototransduction egz04910   Insulin signaling pathway egz04912   GnRH signaling pathway egz04916   Melanogenesis Brite KEGG Orthology (KO) [BR:egz00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     118452301    04020 Calcium signaling pathway     118452301    04070 Phosphatidylinositol signaling system     118452301  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     118452301    04218 Cellular senescence     118452301  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118452301   09152 Endocrine system    04910 Insulin signaling pathway     118452301    04912 GnRH signaling pathway     118452301    04916 Melanogenesis     118452301   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     118452301    04270 Vascular smooth muscle contraction     118452301   09157 Sensory system    04744 Phototransduction     118452301  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:egz01009]     118452301   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:egz04131]     118452301    03036 Chromosome and associated proteins [BR:egz03036]     118452301   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:egz04147]     118452301 Protein phosphatases and associated proteins [BR:egz01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      118452301 Membrane trafficking [BR:egz04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     118452301 Chromosome and associated proteins [BR:egz03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      118452301 Exosome [BR:egz04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    118452301 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_8 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_9 AIF-1 EF-hand_FSTL1 DUF1103 EF_EFCAB10_C Dockerin_1 DUF6438 Motif Other DBs NCBI-GeneID:  118452301 NCBI-ProteinID:  XP_035750323 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKD GNGYTRAAGVRPGMTNLGEKLTDEEVDEMIREADIDGDGQVNYEGERHCHPRGVPAVTRR LLCHPQFLRP NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgcgctctctgggccagaaccccaccgaggccgagctgcaggacatgatcaacgaggtg gacgccgacggcaacggcaccatcgacttccccgagttcctcaccatgatggcgaggaag atgaaggacacggacagcgaggaggagatccgcgaggctttccgcgtcttcgataaggat gggaacggctacaccagggcggccggggtgcgccccgggatgaccaacctgggggagaag ctgacggatgaggaggtggacgagatgatccgagaggccgacatcgatggtgacggacag gtcaactacgagggtgagcgccactgtcaccccaggggcgtccccgctgtcacccggcgt ctcctctgtcacccacagttcctgcggccttaa

DBGET integrated database retrieval system