Empedobacter haloabium: E7V67_011060 Help Entry E7V67_011060      CDS       T09755                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ehb  Empedobacter haloabium Pathway ehb00261   Monobactam biosynthesis ehb01100   Metabolic pathways ehb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ehb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     E7V67_011060  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ehb01008]     E7V67_011060 Polyketide biosynthesis proteins [BR:ehb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     E7V67_011060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WUR15611 LinkDB All DBs Position 2525279..2525500 Genome browser AA seq 73 aa AA seqDB search MSQDYVNPFDDEQHRFSVLRNARGQYSLWPEFAELPAGWESRFGPAARAECVEYVERHWQ AINPFAPGVAGHA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagccaagactatgtgaacccgttcgacgacgaacaacaccgtttctccgtgctgcgc aacgcccgtggccaatacagcctgtggccggaattcgccgagctgccggccggctgggag agccgtttcgggcccgccgcgcgcgccgaatgcgtcgaatacgtcgagcgccactggcag gccatcaatccgttcgcgcccggcgtggccggccacgcgtga

DBGET integrated database retrieval system