KEGG   Empedobacter haloabium: E7V67_025215
Entry
E7V67_025215      CDS       T09755                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
ehb  Empedobacter haloabium
Pathway
ehb00190  Oxidative phosphorylation
ehb01100  Metabolic pathways
ehb02020  Two-component system
Module
ehb_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:ehb00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    E7V67_025215 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    E7V67_025215 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    E7V67_025215 (petA)
Enzymes [BR:ehb01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     E7V67_025215 (petA)
SSDB
Motif
Pfam: Rieske UCR_Fe-S_N
Other DBs
NCBI-ProteinID: WUR12951
UniProt: A0ABZ1UJS8
LinkDB
Position
complement(5797637..5798245)
AA seq 202 aa
MSIEKQVDPSRRGLLVATCAAGGVVGLGTAGTLVSTFQPSERAKAAGAPVEVDISTLQPG
EMRTVEWRGKPVWILKRTPEMLASLPKLDNQVADPKSERNPDEFTPEYCVNEHRSRKPEI
LVAVGICTHLGCSPSTKFVPGPQPSLPDDWAGGFLCPCHGSTFDIAGRVFKNKPAPDNLV
VPRHMYLSDTKILIGKDEKGEA
NT seq 609 nt   +upstreamnt  +downstreamnt
atgagcatcgagaagcaggtcgatcccagccggcgaggcttgttggtcgcaacatgtgcg
gcaggcggcgtcgtgggtctgggcacagcaggtacactggtcagcaccttccagccctcg
gagcgggccaaggcggccggggctccggtcgaagttgacatctccaccttgcagcccggg
gaaatgcgcaccgtcgaatggcgcggcaagcccgtgtggatcctgaaacgcacgccggaa
atgctggcctcgctgcccaagctggacaaccaggtggccgatccgaagtccgagcgcaat
ccggacgaattcacccccgaatactgcgtcaacgagcaccgctcgcgcaaacccgaaatc
ctcgtcgccgtcggcatctgcacccacctgggctgctcgccgtcgaccaagttcgtgccc
ggcccgcagccttcgctgccggacgactgggccggcggcttcctctgcccctgccacggt
tccaccttcgacatcgccggccgcgtcttcaagaacaagccggcgccggacaacctggtg
gtgccacggcacatgtacctgagcgataccaagatcctgatcggcaaagacgagaaaggc
gaggcataa

DBGET integrated database retrieval system